Lus10009766 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006482 229 / 1e-76 AT4G33380 194 / 9e-60 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G032100 150 / 9e-48 ND /
PFAM info
Representative CDS sequence
>Lus10009766 pacid=23178327 polypeptide=Lus10009766 locus=Lus10009766.g ID=Lus10009766.BGIv1.0 annot-version=v1.0
ATGGGTAGTGAAGAGGGAAGCTCAGTGCAAGATTGGGGCGTATTCGATGGAATAAAAGGATTCTCATCATCCCCAGAAACCCTAATGGCTGAGATCGACA
CTGCAATTACTAAACTGGAATATGAGAGATCCACTGCTCATCTGGACTCCACTTTATCATCTGAACTGGGAGGGATTGAAGCCTCCTCTGGCAGTGAATA
TGATGTTGGGATTGCAGACGAGGCTTATAGGGCTGGGTGTGCAGCTCTGGCTGTTGGAAAGCTTGACCAGGCTCTCCAATCTTTAAACGTATCTCTCTCC
AAGTGTCCCCCTGAGAAGAAATCTGCTGTTGCCAAGCTTCAGTCACTCATTTCCATTACATCCCACCAACTTCACCAGAGTTAA
AA sequence
>Lus10009766 pacid=23178327 polypeptide=Lus10009766 locus=Lus10009766.g ID=Lus10009766.BGIv1.0 annot-version=v1.0
MGSEEGSSVQDWGVFDGIKGFSSSPETLMAEIDTAITKLEYERSTAHLDSTLSSELGGIEASSGSEYDVGIADEAYRAGCAALAVGKLDQALQSLNVSLS
KCPPEKKSAVAKLQSLISITSHQLHQS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10009766 0 1
AT3G53570 AME2, AFC1 FUS3-complementing gene 1 (.1.... Lus10032401 6.7 0.5827
Lus10009807 17.9 0.5579
Lus10031895 31.3 0.5519
AT1G12920 ERF1-2 eukaryotic release factor 1-2 ... Lus10028313 57.5 0.4889
Lus10009804 77.1 0.5044
AT3G12770 MEF22 mitochondrial editing factor ... Lus10018264 89.4 0.4990
AT2G27410 B3 Domain of unknown function (DU... Lus10000815 90.7 0.4824
Lus10037724 96.3 0.4928
AT2G45330 TRPT, EMB1067 2' tRNA phosphotransferase, em... Lus10015875 127.7 0.4762
AT4G38520 Protein phosphatase 2C family ... Lus10025076 137.4 0.4413

Lus10009766 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.