Gene [FLAX] | FIBexDB

Lus10009784 [FLAX]

External link

JGI Phytozome v13

[genome browser]

Symbol

Arabidopsis homologues

Show only best Show top 10

No hit found

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value
Lus10013525 [exp]	59 / 2e-12	ND	/
Lus10033154 [exp]	38 / 0.0002	ND	/
Lus10009189 [exp]	0 / 1	ND	/

Poplar homologues

Show only best Show top 10

No hit found

PFAM info

Representative CDS sequence

Show only first row Show all

>Lus10009784 pacid=23175342 polypeptide=Lus10009784 locus=Lus10009784.g ID=Lus10009784.BGIv1.0 annot-version=v1.0

ATGTCAATTCAAGATTCTTGTGTCAAAGAACCAGTAGTTGGAGTTATAGTGGAATATGCTGAAGTTTGGTCTCAACTCTCAAACTTTGCTGAATTTTCAA

TTTTGTTTGTTACATGGGGATCCGTGGGTAACCAGCAACCGCCCAGGGACTGTTGTGGTAACGATATGGGTGGACGAGCAGGGATGGGGAAAACCGCCGT

AATCAATGGGCGGGGAACGGATACCCCTTACCTGGCCCTGATCCGCCCCGATGCCACCCTTACGAGGAAGACTCTTTTCTTCCCGACCCCTAAGGAAGTC

ACCCTCTGA

AA sequence

Show only first row Show all

>Lus10009784 pacid=23175342 polypeptide=Lus10009784 locus=Lus10009784.g ID=Lus10009784.BGIv1.0 annot-version=v1.0

MSIQDSCVKEPVVGVIVEYAEVWSQLSNFAEFSILFVTWGSVGNQQPPRDCCGNDMGGRAGMGKTAVINGRGTDTPYLALIRPDATLTRKTLFFPTPKEV

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10009784 [exp]	0	1

Lus10009784 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.