Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G66680 83 / 6e-20 DGL1 DEFECTIVE GLYCOSYLATION, dolichyl-diphosphooligosaccharide-protein glycosyltransferase 48kDa subunit family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014330 [exp] 104 / 8e-28 AT5G66680 705 / 0.0 DEFECTIVE GLYCOSYLATION, dolichyl-diphosphooligosaccharide-protein glycosyltransferase 48kDa subunit family protein (.1) Lus10026039 [exp] 104 / 1e-27 AT5G66680 702 / 0.0 DEFECTIVE GLYCOSYLATION, dolichyl-diphosphooligosaccharide-protein glycosyltransferase 48kDa subunit family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G127000 [exp] 92 / 2e-23 AT5G66680 622 / 0.0 DEFECTIVE GLYCOSYLATION, dolichyl-diphosphooligosaccharide-protein glycosyltransferase 48kDa subunit family protein (.1) Potri.007G031000 [exp] 91 / 6e-23 AT5G66680 602 / 0.0 DEFECTIVE GLYCOSYLATION, dolichyl-diphosphooligosaccharide-protein glycosyltransferase 48kDa subunit family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009792 pacid=23159586 polypeptide=Lus10009792 locus=Lus10009792.g ID=Lus10009792.BGIv1.0 annot-version=v1.0 ATGGGTTGCATTTCGCGTGTTTTGATTGACTTCGTTGACTCGGGTCATGATTTGATTATAGCAGTGAATACTTCTGCTTCTGATTTGATTAAGAACATAG CTACGGAGTGTGGAGTTGATTTTGATGAGGAGCCGTCTGCTATGGTTATTAATCACCAAAGCTATGCAATGTCCAAAATCGAGGTAGTTCATTCGATTAT GTTCAAGAAGCATGTATTCGCCCAAGATTTGGAAATGAACGAGGAGGAGAACCTATTGGGTAGAGTTGGGAAATTAGGCCAAACTGTAAGGGTGATTTAG
AA sequence Show only first row Show all	>Lus10009792 pacid=23159586 polypeptide=Lus10009792 locus=Lus10009792.g ID=Lus10009792.BGIv1.0 annot-version=v1.0 MGCISRVLIDFVDSGHDLIIAVNTSASDLIKNIATECGVDFDEEPSAMVINHQSYAMSKIEVVHSIMFKKHVFAQDLEMNEEENLLGRVGKLGQTVRVI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G66680		DGL1	DEFECTIVE GLYCOSYLATION, dolic...		Lus10009792 [exp]	0	1
AT3G07525		ATG10, ATATG10	autophagy 10, autophagocytosis...		Lus10002145 [exp]	6.9	0.8017
AT1G74910			ADP-glucose pyrophosphorylase ...		Lus10015338 [exp]	7.3	0.8079
AT5G24314		PDE225, PTAC7	PIGMENT DEFECTIVE 225, plastid...		Lus10041454 [exp]	10.1	0.8085
AT3G03990			alpha/beta-Hydrolases superfam...		Lus10013541 [exp]	13.5	0.7825
AT5G06340		ATNUDX27	nudix hydrolase homolog 27 (.1...		Lus10021279 [exp]	20.2	0.7850
AT1G20693		HMGBETA1, NFD2,...	NUCLEOSOME/CHROMATIN ASSEMBLY ...		Lus10013219 [exp]	22.3	0.7981
AT5G06340		ATNUDX27	nudix hydrolase homolog 27 (.1...		Lus10016956 [exp]	25.1	0.7890
AT1G32070		ATNSI	nuclear shuttle interacting (....		Lus10035604 [exp]	31.3	0.7681
AT1G53120			RNA-binding S4 domain-containi...		Lus10041931 [exp]	33.1	0.7580
AT4G01940		ATCNFU1, NFU1	NFU domain protein 1 (.1)		Lus10009999 [exp]	33.5	0.7453

Compare expression of checked genes

Lus10009792 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.