Lus10009804 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000446 115 / 7e-33 AT5G37720 211 / 1e-66 interacting with DNA-binding domain of Zn-finger PARP 1, ALWAYS EARLY 4 (.1.2)
Lus10011667 89 / 2e-22 AT5G25900 624 / 0.0 CYTOCHROME P450 701 A3, ARABIDOPSIS THALIANA ENT-KAURENE OXIDASE 1, GA requiring 3 (.1)
Lus10010982 87 / 4e-22 AT5G37720 209 / 7e-66 interacting with DNA-binding domain of Zn-finger PARP 1, ALWAYS EARLY 4 (.1.2)
Lus10005895 36 / 0.0007 AT5G02530 185 / 8e-58 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G087000 59 / 5e-12 AT5G37720 213 / 2e-68 interacting with DNA-binding domain of Zn-finger PARP 1, ALWAYS EARLY 4 (.1.2)
Potri.017G129900 52 / 1e-09 AT1G66260 216 / 3e-69 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2)
Potri.001G236900 36 / 0.0008 AT5G59950 187 / 2e-59 RNA-binding (RRM/RBD/RNP motifs) family protein
PFAM info
Representative CDS sequence
>Lus10009804 pacid=23159594 polypeptide=Lus10009804 locus=Lus10009804.g ID=Lus10009804.BGIv1.0 annot-version=v1.0
ATGGCCACTTCTGTTGATATGTCTCTTGATGATATTACTAAGAGCAGTAGAGGGAAAGGCAGAGGTCAATGTACTGCTCGACGTGGAAGAAGTTCTGGTA
GGCCATTCAATGCTGGAAAAATGACAGGGCCAGTTCGTAGGGGTCCGTTTGGAGTTAATAGACGACCATCCCAGTTTGCAATTTCCGAGGAAAGCTCAAA
ACTGAGGGTCTCATGA
AA sequence
>Lus10009804 pacid=23159594 polypeptide=Lus10009804 locus=Lus10009804.g ID=Lus10009804.BGIv1.0 annot-version=v1.0
MATSVDMSLDDITKSSRGKGRGQCTARRGRSSGRPFNAGKMTGPVRRGPFGVNRRPSQFAISEESSKLRVS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10009804 0 1
AT4G30200 VEL1, VIL2 VIN3-Like 2, vernalization5/VI... Lus10040339 3.7 0.8032
AT2G37880 Protein of unknown function, D... Lus10021495 7.5 0.8146
AT1G75250 MYB RSM3, ATRL6 RADIALIS-LIKE SANT/MYB 3, RAD-... Lus10040450 7.5 0.6516
AT4G03230 S-locus lectin protein kinase ... Lus10033752 8.9 0.7725
AT1G67623 F-box family protein (.1) Lus10030790 13.0 0.7922
AT4G19170 CCD4, NCED4 carotenoid cleavage dioxygenas... Lus10035700 18.8 0.7903
Lus10000801 21.2 0.6766
AT4G29250 HXXXD-type acyl-transferase fa... Lus10028335 24.6 0.7299
AT5G57820 zinc ion binding (.1) Lus10007703 25.1 0.7228
AT1G33530 F-box family protein (.1) Lus10014984 27.9 0.7264

Lus10009804 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.