Lus10009826 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G00590 405 / 3e-140 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
AT3G16150 69 / 8e-13 ASPGB1 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
AT5G08100 65 / 1e-11 ASPGA1 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
AT5G61540 52 / 4e-07 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040935 677 / 0 AT4G00590 484 / 8e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10024795 74 / 3e-14 AT3G16150 536 / 0.0 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Lus10034655 66 / 8e-12 AT5G08100 507 / 0.0 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10034668 64 / 3e-11 AT5G08100 489 / 6e-176 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G080600 455 / 9e-160 AT4G00590 486 / 1e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Potri.014G022900 73 / 3e-14 AT3G16150 556 / 0.0 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Potri.002G122900 71 / 1e-13 AT3G16150 540 / 0.0 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Potri.012G063400 64 / 3e-11 AT5G08100 485 / 2e-174 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0052 NTN PF01112 Asparaginase_2 Asparaginase
Representative CDS sequence
>Lus10009826 pacid=23180143 polypeptide=Lus10009826 locus=Lus10009826.g ID=Lus10009826.BGIv1.0 annot-version=v1.0
ATGGACGGTTGCGACGATGAGGAAGCAAGCCCTAGATTCTTTGTTGCTGTCCACGTTGGTGCAGGATATCGCGCTCCTACCAACGAGAAAGCCCTGCGAT
CCGCCATGAAACGCGCTTGCACTGCTGCTGCTTCTCTACTTCGCCAGGATGATCCGTGTACAAATGCCGGCAGAGGTTCGAATTTAACAGAAGATGGGCT
AGTGGAATGCGATGCTAGTGTTATGGATGGCGATTCTGGTTCTTTTGGAGCTGTTGGTGTAGTGTCAGGTGTGAGAAATCCCATCAAGATTGCTGCTTTA
CTTGCCAAGGAACAGATGGCGGATTCTTCATTGTTGGGTCGAATACCTCCAATGTTTTTGGCAGGCGATGGTGCTCATGCGTGGGCAAGATCAAAAGGCA
TTCTTTTGGAAGATACCGTGGAAGAGGCTGAGAAGTGGCTGGTAACAAAAAGGGCAAAAGCACAGTGGGCAAAGTTCAAAGAAATGCTCCATAGTGCCAA
TACTTCGATCGACACTTTTGATGGGAAAGGGTCTGCCACAGTATCAGGAGGACATGGTGGTGCTTTATCAGTTGTGCCAACATCTCTCGGGGAAGACTCT
GTAATGGACACTGTTGGAGTTGTTTGTGTCGACAATGAAGGACACATAGCTTCTGGGGCCTCTAGTGGTGGTATAGCCCTGAAGGTTGGAGGGCGAGTTG
GGTTAGCTGCGATGTATGGTTCAGGTTGTTGGGCAGCATCAACAAGTCCCTCTGGTGATCCATTCATAGTCGGTGGTTGTGTTTCCGGTGCTGGGGAATC
CTTGATGAAAGGATTTGCAGCTCGGGAATGTTGTGTCTCCACTTCAATTTCTCAGGAAGGCCCTGCATCTGCTAGCAGGAACGTTCTAAGGTCACTAAAA
CTGGACCGCAACTGCGATCAAGATGGTGGAAATCAAAGTGCAGGAATTCTACTCGGGCAAGCAGATGCACCAACTGCAACTTCAGGCTGCTCAAGAAAGC
TGAAAGCTGTAGAGATAGCAGCTGCATTCTCGTCCTTGTCTTTCGGGATAGGTTATCTTGGGAACTCAATGGAACGGCCAAAGGTATCAGTTCTACGGAA
AACGAATCTAGGCAAGACAGGAATCGACCATTTCGAAGAACGGATCGACCTCTATTCCGGTGGATCTTAG
AA sequence
>Lus10009826 pacid=23180143 polypeptide=Lus10009826 locus=Lus10009826.g ID=Lus10009826.BGIv1.0 annot-version=v1.0
MDGCDDEEASPRFFVAVHVGAGYRAPTNEKALRSAMKRACTAAASLLRQDDPCTNAGRGSNLTEDGLVECDASVMDGDSGSFGAVGVVSGVRNPIKIAAL
LAKEQMADSSLLGRIPPMFLAGDGAHAWARSKGILLEDTVEEAEKWLVTKRAKAQWAKFKEMLHSANTSIDTFDGKGSATVSGGHGGALSVVPTSLGEDS
VMDTVGVVCVDNEGHIASGASSGGIALKVGGRVGLAAMYGSGCWAASTSPSGDPFIVGGCVSGAGESLMKGFAARECCVSTSISQEGPASASRNVLRSLK
LDRNCDQDGGNQSAGILLGQADAPTATSGCSRKLKAVEIAAAFSSLSFGIGYLGNSMERPKVSVLRKTNLGKTGIDHFEERIDLYSGGS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G00590 N-terminal nucleophile aminohy... Lus10009826 0 1
AT3G63150 ATCBG, MIRO2 CALCIUM BINDING GTP-ASE, MIRO-... Lus10042575 32.8 0.7283
AT4G38120 ARM repeat superfamily protein... Lus10008299 32.9 0.7608
AT1G58360 NAT2, AAP1 NEUTRAL AMINO ACID TRANSPORTER... Lus10033759 56.9 0.7189
AT5G42400 SDG25, ATXR7 ARABIDOPSIS TRITHORAX-RELATED7... Lus10025172 79.7 0.7089
AT1G38065 O-fucosyltransferase family pr... Lus10025631 104.4 0.7272
AT4G24290 MAC/Perforin domain-containing... Lus10035789 111.4 0.6895
AT1G55090 carbon-nitrogen hydrolase fami... Lus10017307 127.4 0.7209
AT3G52570 alpha/beta-Hydrolases superfam... Lus10022689 149.9 0.6788
AT1G38131 O-fucosyltransferase family pr... Lus10025630 150.2 0.6910
AT1G15240 Phox-associated domain;Phox-li... Lus10035877 223.8 0.6633

Lus10009826 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.