Lus10009828 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G13410 267 / 4e-90 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT4G19830 56 / 3e-09 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT3G60370 48 / 2e-06 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT4G26555 44 / 3e-05 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT2G43560 43 / 6e-05 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT1G18170 43 / 0.0001 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
AT1G73655 40 / 0.0006 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040937 346 / 2e-121 AT5G13410 317 / 1e-109 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10036206 62 / 2e-11 AT4G19830 260 / 4e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10038345 58 / 6e-10 AT4G19830 262 / 3e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10042897 58 / 7e-10 AT3G60370 312 / 8e-109 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10028194 56 / 7e-09 AT3G60370 305 / 2e-104 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10027246 43 / 9e-05 AT1G18170 187 / 2e-59 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10027115 41 / 0.0004 AT2G43560 276 / 5e-94 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10008359 41 / 0.0005 AT2G43560 273 / 1e-93 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G068300 280 / 1e-95 AT5G13410 332 / 4e-116 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.012G119800 55 / 8e-09 AT4G19830 270 / 5e-92 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.014G045600 53 / 5e-08 AT3G60370 302 / 3e-104 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.001G467100 48 / 1e-06 AT4G26555 268 / 3e-92 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.007G134600 44 / 5e-05 AT2G43560 286 / 2e-98 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Potri.017G017500 40 / 0.0006 AT2G43560 281 / 3e-96 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0487 FKBP PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Representative CDS sequence
>Lus10009828 pacid=23180153 polypeptide=Lus10009828 locus=Lus10009828.g ID=Lus10009828.BGIv1.0 annot-version=v1.0
ATGGCTATGGCGTCCATTTCATCTGCAGCAGCTGCTCTTCTCAGTTGGAGGTCCTCTTCTTCTTCTTCTTCTTCTTCTTTGTCAGCTACCACATGGCGGA
GCAGACCCATCTCATCTCTTCATCAGTCCCAGGATTCTACACCACACATTGGAAAAACAAGCCTAAGTGTTCTTGGCAGAAGACAAGCTTCCCTGCTTTC
ACTTGGATTTCTACTACCTCGATTTAATAGAGATGGAGTAGCTACTGCTTCTGAATTTGCAGACATGCCTGCACTAAGGGGGAAGGATTATGGCAAGTCC
AAAATGCGGTACCCGGACTATACTGAAACTAGTTCTGGCCTCCAGTATAAGGACCTTCGTCAAGGAACTGGCGCTACGCCTAATGTAGGAGAGACCGTTG
TGGTAGATTGGGATGGTTATACAATAGGGTACTATGGCCGTATATTCGAAGCTCGGAATAAGTCCAAAGGTGGTTCTTTTGAGGGAGACGACAAGGACTT
TTTCAAGTTTAAACTGGGATCCGGAGAGGTAATACCAGCATTTGAGGAAGCTGTTTCAGGCATGGCTTTGGGTGGCATCCGAAGGATAGTTGTGCCACCG
GAGCTTGGGTACCCTGACAACGACTACAATAAGAGTGCCCCAAGGCCGACCACCTTTTCGGGACAGAGAGCGTTGGACTTTGTGCTGAGGAACCAAGGTC
TGATTGACAAAACTCTGTTGTTTGACATCGAACTCATTAAAATCCTCCGACCATCAAGCTGA
AA sequence
>Lus10009828 pacid=23180153 polypeptide=Lus10009828 locus=Lus10009828.g ID=Lus10009828.BGIv1.0 annot-version=v1.0
MAMASISSAAAALLSWRSSSSSSSSSLSATTWRSRPISSLHQSQDSTPHIGKTSLSVLGRRQASLLSLGFLLPRFNRDGVATASEFADMPALRGKDYGKS
KMRYPDYTETSSGLQYKDLRQGTGATPNVGETVVVDWDGYTIGYYGRIFEARNKSKGGSFEGDDKDFFKFKLGSGEVIPAFEEAVSGMALGGIRRIVVPP
ELGYPDNDYNKSAPRPTTFSGQRALDFVLRNQGLIDKTLLFDIELIKILRPSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G13410 FKBP-like peptidyl-prolyl cis-... Lus10009828 0 1
AT2G35450 catalytics;hydrolases (.1) Lus10037047 1.4 0.9135
AT1G16445 S-adenosyl-L-methionine-depend... Lus10031174 5.4 0.8651
AT3G10405 unknown protein Lus10037959 7.4 0.9219
AT5G13410 FKBP-like peptidyl-prolyl cis-... Lus10040937 10.8 0.9014
AT5G22340 unknown protein Lus10034185 18.4 0.9002
AT2G01755 unknown protein Lus10030691 21.1 0.8936
AT4G04900 RIC10 ROP-interactive CRIB motif-con... Lus10007648 25.4 0.8352
AT1G11340 S-locus lectin protein kinase ... Lus10024064 27.1 0.8520
AT5G14910 Heavy metal transport/detoxifi... Lus10032167 30.3 0.8888
AT5G11450 PPD5 PsbP domain protein 5, Mog1/Ps... Lus10022110 31.7 0.8899

Lus10009828 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.