Lus10009832 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G11110 90 / 4e-23 RING/U-box superfamily protein (.1)
AT3G10910 81 / 2e-19 RING/U-box superfamily protein (.1)
AT1G23980 79 / 1e-17 RING/U-box superfamily protein (.1)
AT1G72200 78 / 3e-17 RING/U-box superfamily protein (.1)
AT5G05280 75 / 4e-17 RING/U-box superfamily protein (.1)
AT5G27420 77 / 6e-17 CNI1, ATL31 carbon/nitrogen insensitive 1 (.1)
AT3G18930 75 / 5e-16 RING/U-box superfamily protein (.1.2)
AT3G05200 74 / 1e-15 ATL6 RING/U-box superfamily protein (.1)
AT3G48030 73 / 2e-15 hypoxia-responsive family protein / zinc finger (C3HC4-type RING finger) family protein (.1)
AT2G27940 71 / 2e-15 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040942 277 / 2e-96 AT3G11110 109 / 1e-30 RING/U-box superfamily protein (.1)
Lus10002194 82 / 4e-19 AT2G42360 153 / 4e-46 RING/U-box superfamily protein (.1)
Lus10037490 82 / 1e-18 AT3G16720 224 / 2e-70 TOXICOS EN LEVADURA 2 (.1)
Lus10006493 79 / 8e-18 AT3G16720 221 / 5e-71 TOXICOS EN LEVADURA 2 (.1)
Lus10016163 77 / 2e-17 AT2G27940 133 / 1e-38 RING/U-box superfamily protein (.1)
Lus10031515 76 / 2e-16 AT3G05200 232 / 1e-73 RING/U-box superfamily protein (.1)
Lus10022743 73 / 2e-16 AT3G10910 154 / 5e-48 RING/U-box superfamily protein (.1)
Lus10036466 76 / 3e-16 AT1G72200 186 / 6e-55 RING/U-box superfamily protein (.1)
Lus10041134 75 / 5e-16 AT1G72200 182 / 3e-54 RING/U-box superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G071000 122 / 7e-36 AT3G11110 122 / 3e-36 RING/U-box superfamily protein (.1)
Potri.001G212101 80 / 3e-18 AT2G27940 96 / 2e-23 RING/U-box superfamily protein (.1)
Potri.010G010500 80 / 3e-18 AT3G16720 202 / 1e-63 TOXICOS EN LEVADURA 2 (.1)
Potri.006G144200 77 / 7e-18 AT5G17600 90 / 3e-21 RING/U-box superfamily protein (.1)
Potri.019G091400 78 / 1e-17 AT2G42360 143 / 9e-42 RING/U-box superfamily protein (.1)
Potri.011G063100 77 / 2e-17 AT2G42350 106 / 3e-28 RING/U-box superfamily protein (.1)
Potri.019G130100 76 / 3e-17 AT5G05280 129 / 5e-38 RING/U-box superfamily protein (.1)
Potri.013G091300 75 / 7e-17 AT3G10910 153 / 2e-47 RING/U-box superfamily protein (.1)
Potri.001G159300 73 / 1e-16 AT5G05280 134 / 3e-40 RING/U-box superfamily protein (.1)
Potri.018G085001 76 / 2e-16 AT4G28890 290 / 2e-94 RING/U-box superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10009832 pacid=23180201 polypeptide=Lus10009832 locus=Lus10009832.g ID=Lus10009832.BGIv1.0 annot-version=v1.0
ATGGCTTCGACATCATCGTCGTCATTGAAAGAGTCCCGACCAGACCACTCGCACTTCACTGAGCTAGAGGACCACCAGTTCCAGATCCGAGGCAGAACAG
TCTTCTTCGCCATCCTAACCTTTGCACTCGTTGTATTCATTGTCCTCCTCCTCCTCTGTACTCGCTGGCTCTACCGTTACCGGCAACGCCGAAACGGACT
CTCCCACGCTCCCCGCTCATCCGACGGGAATCCGCAATACTGCCGTGGGCTTGACGCGCTTACAATCGCTGCCATACCCATTACCCTACACTCCTCCTCC
GCAATAATGGAGTGCTGTATTTGCCTAGGCACGTTTGAAGACGGGGACAAGGTCAAGTCCTTGCCACGTTGTCACCATTGTTTCCACTCGGAGTGTGTGG
ACCGTTGGCTCCTCGCCCACTGTGATTGCCCACTCTGTAGAGCTTCAGTAGTTGTTGACCCGGTCCGCGAGCAAGTAGTCATAGTTGTTGACTCTGCGAT
CAGTACCAGATCAGGTGGTCTTGATGTCTGA
AA sequence
>Lus10009832 pacid=23180201 polypeptide=Lus10009832 locus=Lus10009832.g ID=Lus10009832.BGIv1.0 annot-version=v1.0
MASTSSSSLKESRPDHSHFTELEDHQFQIRGRTVFFAILTFALVVFIVLLLLCTRWLYRYRQRRNGLSHAPRSSDGNPQYCRGLDALTIAAIPITLHSSS
AIMECCICLGTFEDGDKVKSLPRCHHCFHSECVDRWLLAHCDCPLCRASVVVDPVREQVVIVVDSAISTRSGGLDV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G11110 RING/U-box superfamily protein... Lus10009832 0 1
AT3G55370 DOF OBP3, AtDof3. 6 OBF-binding protein 3 (.1.2.3) Lus10040305 5.9 0.7429
AT2G02230 ATPP2-B1 phloem protein 2-B1 (.1) Lus10042713 13.7 0.7047
AT5G50790 SWEET10, AtSWEE... Nodulin MtN3 family protein (.... Lus10022436 20.6 0.6896
AT5G67300 MYB ATMYB44, AtMYBr... ARABIDOPSIS THALIANA MYB DOMAI... Lus10019314 23.0 0.6591
AT2G37590 DOF AtDof2. 4, ATDO... DNA binding with one finger 2.... Lus10040836 23.4 0.6704
AT2G34140 DOF AtDof2. 3 Dof-type zinc finger DNA-bindi... Lus10001896 23.4 0.6940
AT4G12300 CYP706A4 "cytochrome P450, family 706, ... Lus10024577 28.6 0.6765
AT1G13680 PLC-like phosphodiesterases su... Lus10035130 28.6 0.6708
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10002738 31.9 0.6813
AT5G42200 RING/U-box superfamily protein... Lus10021842 33.1 0.5330

Lus10009832 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.