Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05500 172 / 8e-55 MOP10 Pollen Ole e 1 allergen and extensin family protein (.1) AT3G09925 81 / 3e-19 Pollen Ole e 1 allergen and extensin family protein (.1) AT2G34700 71 / 2e-15 Pollen Ole e 1 allergen and extensin family protein (.1) AT2G33790 71 / 6e-15 ATAGP30 arabinogalactan protein 30 (.1) AT1G28290 58 / 2e-10 AGP31 arabinogalactan protein 31 (.1.2) AT2G47530 55 / 1e-09 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G15780 48 / 8e-07 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G02270 45 / 3e-06 RHS13 root hair specific 13 (.1) AT3G62680 46 / 5e-06 ATPRP3, PRP3 ARABIDOPSIS THALIANA PROLINE-RICH PROTEIN 3, proline-rich protein 3 (.1) AT1G54970 44 / 2e-05 RHS7, ATPRP1 ROOT HAIR SPECIFIC 7, proline-rich protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040948 [exp] 347 / 4e-124 AT5G05500 176 / 9e-57 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10017440 [exp] 195 / 4e-64 AT5G05500 128 / 7e-38 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10007515 [exp] 174 / 8e-56 AT5G05500 127 / 3e-37 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10015434 [exp] 76 / 6e-17 AT1G28290 135 / 1e-39 arabinogalactan protein 31 (.1.2) Lus10014013 [exp] 74 / 4e-16 AT2G34700 137 / 2e-40 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10023887 [exp] 62 / 7e-12 AT3G09925 167 / 4e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10025526 [exp] 51 / 1e-07 AT1G28290 41 / 0.002 arabinogalactan protein 31 (.1.2) Lus10005086 [exp] 49 / 5e-07 AT5G15780 133 / 5e-35 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10001895 [exp] 47 / 1e-06 AT1G29140 157 / 2e-49 Pollen Ole e 1 allergen and extensin family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G185400 [exp] 207 / 5e-69 AT5G05500 166 / 8e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.008G072000 [exp] 189 / 2e-61 AT5G05500 152 / 5e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.004G044700 [exp] 79 / 3e-18 AT2G34700 142 / 8e-43 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.011G053600 [exp] 74 / 4e-16 AT2G34700 139 / 5e-41 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.017G068400 [exp] 59 / 2e-11 AT5G41050 172 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.006G119100 [exp] 59 / 7e-11 AT3G09925 180 / 7e-58 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.014G126300 [exp] 57 / 5e-10 AT2G47540 114 / 1e-30 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.014G126200 [exp] 57 / 8e-10 AT2G47540 114 / 3e-30 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.014G126500 [exp] 57 / 9e-10 AT2G47540 113 / 6e-30 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G326200 [exp] 54 / 2e-09 AT5G41050 158 / 9e-50 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0287 [flax] [poplar] Transthyretin PF01190 [flax] [poplar] Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence Show only first row Show all	>Lus10009837 pacid=23180203 polypeptide=Lus10009837 locus=Lus10009837.g ID=Lus10009837.BGIv1.0 annot-version=v1.0 ATGGAACCAAGCAACCACCTGACATCAGCTGCCATCTGCTCCCTCTTTCTGCTCCTCCCATTCGTTATGGCTTTCCCAGCAGCATCAGCTGATCAGAAGA AGATATCTGATCATGTGGTTGTTGAAGGAGTTGTCTACTGCCAGCGCTGCCACAACTCTGGCTCGTGGTCTCTCTCAGGGGCAAACCCCCTCCACTCTGC TACAGTCAGTGTCATTTGTAAGAATTCCCACAACCAAGTCAGCTTCTACAAGACGTATCAGACCAACGAATATGGCTACTTCTACGCTCAGCTCGATGGC TTCAAGTTAGGCCATGGCATTCTGGACCATCCTCTTCAAGCCTGCACTGTCAAGCTTGTTTCCTCTCCTCTTCAGACCTGCAATGTCCCTACCAACCTCA ACTATGGCATCAAAGGAGCTAAGCTTCGTTTCGAGAACAAGGTCCTCAGGTCCCCTCACTATGAGGCCGTCATCTATGCTGCTGGTCCGTTAGCCTTCCG CCCCAGTGAATGCCCTTCAGCAGCTGAAGAAGATGTGCATGCTTGA
AA sequence Show only first row Show all	>Lus10009837 pacid=23180203 polypeptide=Lus10009837 locus=Lus10009837.g ID=Lus10009837.BGIv1.0 annot-version=v1.0 MEPSNHLTSAAICSLFLLLPFVMAFPAASADQKKISDHVVVEGVVYCQRCHNSGSWSLSGANPLHSATVSVICKNSHNQVSFYKTYQTNEYGYFYAQLDG FKLGHGILDHPLQACTVKLVSSPLQTCNVPTNLNYGIKGAKLRFENKVLRSPHYEAVIYAAGPLAFRPSECPSAAEEDVHA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G05500		MOP10	Pollen Ole e 1 allergen and ex...		Lus10009837 [exp]	0	1
AT5G05500		MOP10	Pollen Ole e 1 allergen and ex...		Lus10040948 [exp]	1.0	0.9754
AT1G48930		ATGH9C1	glycosyl hydrolase 9C1 (.1)		Lus10017402 [exp]	1.4	0.9628
AT1G63450		RHS8	root hair specific 8 (.1)		Lus10000604 [exp]	1.7	0.9562
AT1G12560		ATHEXPALPHA1.26...	expansin A7 (.1)		Lus10006711 [exp]	2.8	0.9537
AT4G02270		RHS13	root hair specific 13 (.1)		Lus10041926 [exp]	4.2	0.9390
AT4G02270		RHS13	root hair specific 13 (.1)		Lus10013419 [exp]	4.9	0.9252
AT3G10710		RHS12	root hair specific 12 (.1)		Lus10033399 [exp]	5.0	0.9390
AT4G30320			CAP (Cysteine-rich secretory p...		Lus10019993 [exp]	5.5	0.9042
AT4G33880	bHLH	RSL2, bHLH085	ROOT HAIR DEFECTIVE 6-LIKE 2 (...		Lus10004315 [exp]	6.5	0.8704
AT4G28850		ATXTH26, XTH26,...	xyloglucan endotransglucosylas...		Lus10011112 [exp]	6.9	0.8779

Compare expression of checked genes

Lus10009837 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.