Lus10009847 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G41430 56 / 1e-10 LSR1, CID1, ERD15 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
AT4G14270 54 / 1e-09 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040964 186 / 9e-62 AT2G41430 69 / 2e-15 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10035419 61 / 8e-13 AT2G41430 113 / 2e-33 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10031029 61 / 9e-13 AT2G41430 115 / 3e-34 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10019769 57 / 7e-11 AT2G41430 91 / 1e-23 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10016358 57 / 1e-10 AT2G41430 83 / 1e-20 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10018018 56 / 1e-10 AT2G41430 102 / 8e-29 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10042014 54 / 8e-10 AT2G41430 99 / 1e-27 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G074600 114 / 3e-33 AT4G14270 66 / 2e-14 unknown protein
Potri.010G182800 112 / 2e-32 AT4G14270 65 / 6e-14 unknown protein
Potri.016G041600 64 / 2e-13 AT2G41430 121 / 1e-35 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Potri.006G044600 62 / 3e-13 AT2G41430 122 / 3e-36 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Potri.001G023100 62 / 8e-13 AT4G14270 89 / 3e-23 unknown protein
Potri.003G202500 62 / 1e-12 AT2G41430 81 / 5e-20 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07145 PAM2 Ataxin-2 C-terminal region
Representative CDS sequence
>Lus10009847 pacid=23180161 polypeptide=Lus10009847 locus=Lus10009847.g ID=Lus10009847.BGIv1.0 annot-version=v1.0
ATGGATGTAATGTTTGCCCATAGATCATCATCCTCGACCTTGAATCCAGACGCCCCGCTGTTCGTCCCGGTGGAGGACTTCTCCGATCAGTGGTGGGCCC
TCATTCAATCCTCTCCCTGGTTTCGCGACTACTGGCTGCAGGAGCACTACCAAGATCCCCAATCCGATCTTTCCCTCCCCGACGATCTCGATTTCTTTGA
CGACGGCGCCGATTTCCTCCACTTCTCCGGCAAAGATGAGGATGCGAAGAAGAAGGAGGAGGAGGAAGCCAGGCTGAATTGGGATATGATATCGGCTGGA
TCGATGAAATGGAAGAAAGGTCAAGCTGATCTGGCTCGGTCGCCGAGGTACTCTGATAAGCCTGCCAAGATTGTGAATGTGAAGATGAGTCCAAGGTCGA
TTCAGCAGCCCAGGTAG
AA sequence
>Lus10009847 pacid=23180161 polypeptide=Lus10009847 locus=Lus10009847.g ID=Lus10009847.BGIv1.0 annot-version=v1.0
MDVMFAHRSSSSTLNPDAPLFVPVEDFSDQWWALIQSSPWFRDYWLQEHYQDPQSDLSLPDDLDFFDDGADFLHFSGKDEDAKKKEEEEARLNWDMISAG
SMKWKKGQADLARSPRYSDKPAKIVNVKMSPRSIQQPR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G41430 LSR1, CID1, ERD... CTC-Interacting Domain 1, dehy... Lus10009847 0 1
AT5G56550 ATOXS3 oxidative stress 3 (.1) Lus10012939 1.7 0.9264
AT2G37678 PAT3, FRY1, FHY... PHYTOCHROME A SIGNAL TRANSDUCT... Lus10012123 2.0 0.9179
AT5G28770 bZIP BZO2H3, ATBZIP6... Arabidopsis thaliana basic leu... Lus10015913 2.4 0.9166
Lus10015768 4.2 0.8542
AT5G56550 ATOXS3 oxidative stress 3 (.1) Lus10034985 5.3 0.9092
AT3G01470 HD HD-ZIP-1, HAT5,... HOMEODOMAIN PROTEIN FROM ARABI... Lus10025232 5.3 0.8833
AT2G27310 F-box family protein (.1) Lus10003731 5.7 0.8718
AT5G28770 bZIP BZO2H3, ATBZIP6... Arabidopsis thaliana basic leu... Lus10006590 6.0 0.8701
Lus10011136 6.7 0.8744
AT1G64280 SAI1, NIM1, NPR... SALICYLIC ACID INSENSITIVE 1, ... Lus10018756 7.2 0.8687

Lus10009847 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.