Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05365 89 / 5e-25 Heavy metal transport/detoxification superfamily protein (.1) AT5G19090 47 / 1e-07 Heavy metal transport/detoxification superfamily protein (.1.2.3) AT3G56240 44 / 5e-07 ATX1, CCH copper chaperone (.1) AT3G56891 44 / 6e-07 Heavy metal transport/detoxification superfamily protein (.1) AT3G06130 44 / 2e-06 Heavy metal transport/detoxification superfamily protein (.1.2) AT1G66240 42 / 3e-06 ATX1, ATATX1 homolog of anti-oxidant 1 (.1.2.3) AT1G71050 42 / 7e-06 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT5G02600 41 / 2e-05 NPCC6, NAKR1 nuclear-enriched phloem companion cell gene 6, SODIUM POTASSIUM ROOT DEFECTIVE 1, Heavy metal transport/detoxification superfamily protein (.1.2) AT2G37390 39 / 7e-05 NAKR2 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) AT5G27690 39 / 0.0001 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040965 [exp] 123 / 1e-38 AT5G05365 117 / 2e-36 Heavy metal transport/detoxification superfamily protein (.1) Lus10024435 [exp] 45 / 7e-07 AT2G37390 144 / 2e-41 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Lus10025294 [exp] 45 / 1e-06 AT2G37390 141 / 3e-40 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Lus10043444 [exp] 44 / 1e-06 AT1G66240 127 / 4e-39 homolog of anti-oxidant 1 (.1.2.3) Lus10028859 [exp] 43 / 3e-06 AT1G66240 125 / 8e-38 homolog of anti-oxidant 1 (.1.2.3) Lus10014120 [exp] 43 / 3e-06 AT4G38580 253 / 5e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10019789 [exp] 43 / 3e-06 AT4G38580 254 / 4e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10015174 [exp] 43 / 4e-06 AT5G27690 124 / 2e-32 Heavy metal transport/detoxification superfamily protein (.1) Lus10041228 [exp] 43 / 5e-06 AT3G06130 149 / 3e-41 Heavy metal transport/detoxification superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G182700 [exp] 94 / 6e-26 AT5G05365 86 / 1e-22 Heavy metal transport/detoxification superfamily protein (.1) Potri.010G236500 [exp] 47 / 1e-08 AT1G66240 129 / 1e-40 homolog of anti-oxidant 1 (.1.2.3) Potri.008G023800 [exp] 46 / 5e-08 AT1G66240 124 / 7e-39 homolog of anti-oxidant 1 (.1.2.3) Potri.002G206900 [exp] 47 / 2e-07 AT5G27690 111 / 3e-28 Heavy metal transport/detoxification superfamily protein (.1) Potri.014G132000 [exp] 45 / 6e-07 AT5G27690 114 / 4e-29 Heavy metal transport/detoxification superfamily protein (.1) Potri.010G024700 [exp] 45 / 8e-07 AT5G27690 114 / 2e-29 Heavy metal transport/detoxification superfamily protein (.1) Potri.013G025300 [exp] 43 / 4e-06 AT3G06130 96 / 2e-21 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.010G114300 [exp] 43 / 4e-06 AT1G23000 128 / 2e-33 Heavy metal transport/detoxification superfamily protein (.1) Potri.010G114600 [exp] 41 / 8e-06 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Potri.008G202800 [exp] 42 / 1e-05 AT3G06130 150 / 6e-41 Heavy metal transport/detoxification superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10009848 pacid=23180204 polypeptide=Lus10009848 locus=Lus10009848.g ID=Lus10009848.BGIv1.0 annot-version=v1.0 ATGACCAATGTAGTGGAGCTGAAAGTGGGATTACACTGCGACGAATGCATCAAGAAGATCCTCAAGGCCATCAAGAAGATACAAGATATTGAAACATACG AAGTGGATACTCAGCTGAACAAGGTCACCGTGACCGGCAACATCACCACTGAACAAGTGATCCGAGTTATCCACAAGATTGGCAAGACTGCATTCACTTG GGGCGAAGACTCCCAATCCAAACTTTACCAACAGCATCACTTCTAA
AA sequence Show only first row Show all	>Lus10009848 pacid=23180204 polypeptide=Lus10009848 locus=Lus10009848.g ID=Lus10009848.BGIv1.0 annot-version=v1.0 MTNVVELKVGLHCDECIKKILKAIKKIQDIETYEVDTQLNKVTVTGNITTEQVIRVIHKIGKTAFTWGEDSQSKLYQQHHF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G05365			Heavy metal transport/detoxifi...		Lus10009848 [exp]	0	1
AT3G25855			Copper transport protein famil...		Lus10035027 [exp]	3.0	0.9182
					Lus10041944 [exp]	3.9	0.9098
AT5G05365			Heavy metal transport/detoxifi...		Lus10040965 [exp]	6.6	0.9152
AT2G41200			unknown protein		Lus10032687 [exp]	6.7	0.8841
AT3G55740		ATPROT2, ProT2	proline transporter 2 (.1.2)		Lus10040238 [exp]	7.5	0.8905
					Lus10035412 [exp]	7.7	0.8817
					Lus10018627 [exp]	15.0	0.8766
AT1G13920			Remorin family protein (.1)		Lus10026649 [exp]	16.2	0.9040
AT1G13920			Remorin family protein (.1)		Lus10004665 [exp]	18.8	0.9024
AT5G50740			Heavy metal transport/detoxifi...		Lus10039074 [exp]	19.0	0.8402

Compare expression of checked genes

Lus10009848 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.