Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G02350 121 / 3e-33 SEC15B exocyst complex component sec15B (.1) AT3G56640 82 / 2e-19 SEC15A exocyst complex component sec15A (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010295 [exp] 187 / 1e-59 AT4G02350 517 / 5e-179 exocyst complex component sec15B (.1) Lus10010439 [exp] 81 / 8e-19 AT3G56640 1202 / 0.0 exocyst complex component sec15A (.1) Lus10027288 [exp] 74 / 2e-16 AT3G56640 1197 / 0.0 exocyst complex component sec15A (.1) Lus10038993 [exp] 72 / 8e-16 AT3G56640 1216 / 0.0 exocyst complex component sec15A (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G203200 [exp] 153 / 1e-44 AT4G02350 1186 / 0.0 exocyst complex component sec15B (.1) Potri.014G127400 [exp] 151 / 9e-44 AT4G02350 1187 / 0.0 exocyst complex component sec15B (.1) Potri.006G034200 [exp] 85 / 2e-20 AT3G56640 1268 / 0.0 exocyst complex component sec15A (.1) Potri.016G032100 [exp] 82 / 2e-19 AT3G56640 1265 / 0.0 exocyst complex component sec15A (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009857 pacid=23180184 polypeptide=Lus10009857 locus=Lus10009857.g ID=Lus10009857.BGIv1.0 annot-version=v1.0 ATGCTCTCCACAAAGAACCGCCGGAAGATAGCTCCGGCGAACGGAGACGCCAACGACAACTCAGCAGACAAGCAGGAGCAGCTCCTCCTCTTCGCCGCCA TCTACAACGGCGAGGATCTCGGACCTTTCATCCGCAAGGTCTTCGCCACAACAGGTAAGCCCGAGATCCTCCTCCACAATCTCCGTCACTTCGTCCGGTC TAAGGAGTCTGAGATCGAGGAGGTCTGCAAAGCTCACTACCAGGATTTCATCCTCGCCGTGGACGACCGCTCGCAGTGGACGCCCTCCGATCTCTTCTCT CCGATGTCGATTCCTTGA
AA sequence Show only first row Show all	>Lus10009857 pacid=23180184 polypeptide=Lus10009857 locus=Lus10009857.g ID=Lus10009857.BGIv1.0 annot-version=v1.0 MLSTKNRRKIAPANGDANDNSADKQEQLLLFAAIYNGEDLGPFIRKVFATTGKPEILLHNLRHFVRSKESEIEEVCKAHYQDFILAVDDRSQWTPSDLFS PMSIP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G02350		SEC15B	exocyst complex component sec1...		Lus10009857 [exp]	0	1
ATCG01280		ATCG01280.1, YC...	Chloroplast Ycf2;ATPase, AAA t...		Lus10007142 [exp]	6.8	0.8545
ATMG00080		ATMG00080.1, RP...	ribosomal protein L16 (.1)		Lus10004083 [exp]	11.7	0.8860
ATMG00510		ATMG00510.1, NA...	NADH dehydrogenase subunit 7 (...		Lus10015033 [exp]	18.7	0.8820
AT3G63460		EMB2221	transducin family protein / WD...		Lus10016374 [exp]	19.2	0.8829
ATCG00480		ATCG00480.1, AT...	ATP synthase subunit beta (.1)		Lus10032827 [exp]	20.8	0.8481
ATCG00480		ATCG00480.1, AT...	ATP synthase subunit beta (.1)		Lus10009173 [exp]	21.2	0.8486
AT1G13190			RNA-binding (RRM/RBD/RNP motif...		Lus10038759 [exp]	21.4	0.8348
AT2G07675			Ribosomal protein S12/S23 fami...		Lus10002330 [exp]	25.1	0.8816
AT3G08040		ATFRD3, MAN1, F...	MANGANESE ACCUMULATOR 1, FERRI...		Lus10039609 [exp]	26.2	0.8139
ATCG00680		ATCG00680.1, PS...	photosystem II reaction center...		Lus10001686 [exp]	27.1	0.8349

Compare expression of checked genes

Lus10009857 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.