Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G08610 120 / 7e-38 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010288 [exp] 133 / 4e-43 AT3G08610 119 / 2e-37 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G140900 [exp] 92 / 7e-27 AT3G08610 88 / 3e-25 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009864 pacid=23180186 polypeptide=Lus10009864 locus=Lus10009864.g ID=Lus10009864.BGIv1.0 annot-version=v1.0 ATGTCGTTGGTGTGGATGGAAGCTATGCTGCCTCTGGGAATCATCGGCGGTATGCTATGCGTTATGGGCAACTCTCAGTACTACATTCACAAAGCCTATC ACGGCCGGCCTAAGCACATCGGCAACGACATGTGGGACGTCGCCATGGAACGAAGGGACAAGAAGATCGTTGAGAATCTTGTCCCTTCTTCTTCTTCCAA TTAG
AA sequence Show only first row Show all	>Lus10009864 pacid=23180186 polypeptide=Lus10009864 locus=Lus10009864.g ID=Lus10009864.BGIv1.0 annot-version=v1.0 MSLVWMEAMLPLGIIGGMLCVMGNSQYYIHKAYHGRPKHIGNDMWDVAMERRDKKIVENLVPSSSSN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G08610			unknown protein		Lus10009864 [exp]	0	1
AT3G12550		FDM3	factor of DNA methylation 3, X...		Lus10000950 [exp]	11.8	0.6377
					Lus10008962 [exp]	14.2	0.6348
AT5G01650			Tautomerase/MIF superfamily pr...		Lus10022681 [exp]	17.0	0.6631
AT5G23680			Sterile alpha motif (SAM) doma...		Lus10036012 [exp]	26.9	0.6155
AT3G42150			unknown protein		Lus10011614 [exp]	47.6	0.5927
AT5G25760		PEX4, UBC21	ubiquitin-conjugating enzyme 2...		Lus10011695 [exp]	58.2	0.5844
AT2G25720			unknown protein		Lus10032479 [exp]	63.3	0.5854
AT1G27435			unknown protein		Lus10012558 [exp]	75.3	0.5684
AT2G27190		ATPAP12	ARABIDOPSIS THALIANA PURPLE AC...		Lus10024299 [exp]	83.8	0.5397
AT3G17120			unknown protein		Lus10010906 [exp]	93.8	0.5623

Compare expression of checked genes

Lus10009864 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.