Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G01575 54 / 1e-10 serine protease inhibitor, Kazal-type family protein (.1) AT3G61980 51 / 8e-10 serine protease inhibitor, Kazal-type family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010287 [exp] 70 / 4e-17 AT4G01575 72 / 2e-17 serine protease inhibitor, Kazal-type family protein (.1) Lus10009866 [exp] 69 / 8e-17 AT4G01575 70 / 1e-16 serine protease inhibitor, Kazal-type family protein (.1) Lus10010094 [exp] 67 / 2e-16 AT4G01575 61 / 5e-13 serine protease inhibitor, Kazal-type family protein (.1) Lus10010286 [exp] 55 / 2e-11 AT4G01575 63 / 3e-14 serine protease inhibitor, Kazal-type family protein (.1) Lus10030164 [exp] 48 / 7e-09 AT4G01575 59 / 8e-13 serine protease inhibitor, Kazal-type family protein (.1) Lus10030166 [exp] 49 / 2e-08 AT4G01575 134 / 2e-41 serine protease inhibitor, Kazal-type family protein (.1) Lus10007864 [exp] 48 / 2e-08 AT4G01575 129 / 4e-39 serine protease inhibitor, Kazal-type family protein (.1) Lus10010285 [exp] 46 / 7e-08 AT3G61980 66 / 3e-15 serine protease inhibitor, Kazal-type family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G109000 [exp] 59 / 3e-13 AT3G61980 69 / 1e-16 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G108900 [exp] 56 / 4e-12 AT3G61980 67 / 5e-16 serine protease inhibitor, Kazal-type family protein (.1) Potri.002G182800 [exp] 52 / 3e-10 AT4G01575 103 / 4e-29 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G108600 [exp] 52 / 4e-10 AT4G01575 104 / 1e-29 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G108800 [exp] 47 / 2e-08 AT4G01575 57 / 7e-12 serine protease inhibitor, Kazal-type family protein (.1) Potri.015G001800 [exp] 45 / 4e-07 AT4G01575 83 / 4e-21 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G108700 [exp] 43 / 6e-07 AT3G61980 76 / 2e-19 serine protease inhibitor, Kazal-type family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009865 pacid=23180133 polypeptide=Lus10009865 locus=Lus10009865.g ID=Lus10009865.BGIv1.0 annot-version=v1.0 ATGGCGTGCAGGAAGTTGACGGCGTTGGCCCTGATTGCGGCAGTAGTATTGGGGATCTCATTTGGGGGTTCGCCGTTAATGGCCGTGAAGGGAGACGACC CGTGCAAGGGAGTGGAGCAACCCGACGCGCTATCTTGCATAATAAAAGACCCGGTATGCGGAGACGACGGGTATACGTATGAATGCGGCTGCGTGGATGC CTTGTGTAATGAAGCCCGCGTTGTGCGCAAAGGGGAATGCGAGTGA
AA sequence Show only first row Show all	>Lus10009865 pacid=23180133 polypeptide=Lus10009865 locus=Lus10009865.g ID=Lus10009865.BGIv1.0 annot-version=v1.0 MACRKLTALALIAAVVLGISFGGSPLMAVKGDDPCKGVEQPDALSCIIKDPVCGDDGYTYECGCVDALCNEARVVRKGECE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G01575			serine protease inhibitor, Kaz...		Lus10009865 [exp]	0	1
AT3G26300		CYP71B34	"cytochrome P450, family 71, s...		Lus10017676 [exp]	6.5	0.6503
AT2G13980			Polynucleotidyl transferase, r...		Lus10011601 [exp]	8.6	0.6419
AT1G01490			Heavy metal transport/detoxifi...		Lus10024672 [exp]	20.3	0.6151
AT5G17540			HXXXD-type acyl-transferase fa...		Lus10020333 [exp]	20.6	0.6116
AT5G25610		ATRD22, RD22	RESPONSIVE TO DESSICATION 22, ...		Lus10024706 [exp]	31.4	0.5953
AT3G09290	C2H2ZnF	TAC1	telomerase activator1 (.1)		Lus10021213 [exp]	33.0	0.6114
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10023079 [exp]	33.2	0.5790
					Lus10007169 [exp]	44.3	0.5386
AT2G31180	MYB	ATMYB14, Myb14a...	ARABIDOPSIS THALIANA MYB DOMAI...		Lus10022021 [exp]	47.8	0.5916
AT3G02100			UDP-Glycosyltransferase superf...		Lus10003456 [exp]	50.7	0.5916

Compare expression of checked genes

Lus10009865 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.