Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05960 148 / 1e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G53980 144 / 7e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G37870 90 / 3e-24 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G48485 41 / 2e-05 DIR1 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000397 [exp] 225 / 1e-77 AT5G05960 138 / 3e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004677 [exp] 170 / 4e-56 AT5G05960 142 / 8e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10031925 [exp] 73 / 6e-17 AT2G37870 133 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10040249 [exp] 65 / 6e-15 AT3G53980 42 / 2e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10011358 [exp] 44 / 3e-06 AT1G27950 103 / 5e-28 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Lus10030541 [exp] 39 / 0.0002 AT3G07450 116 / 3e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10006413 [exp] 39 / 0.0002 AT1G27950 137 / 5e-41 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G061800 [exp] 187 / 7e-63 AT5G05960 155 / 3e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G196300 [exp] 182 / 8e-61 AT5G05960 150 / 2e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G104300 [exp] 142 / 5e-45 AT3G53980 143 / 2e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.008G141000 [exp] 95 / 3e-26 AT2G37870 121 / 2e-36 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G100600 [exp] 87 / 3e-23 AT2G37870 122 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G251000 [exp] 37 / 0.0006 AT5G48485 76 / 2e-19 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10009872 pacid=23180197 polypeptide=Lus10009872 locus=Lus10009872.g ID=Lus10009872.BGIv1.0 annot-version=v1.0 ATGGCTGCTTCAATGAAGTTGTGCATTTGTCTTGTGGGGTTGGCTGTGGTATTTGGGATATCTGGGTTTGCTGTGGAGGGAGCTGGTGAGTGTGGGAAAT CCACCAACCCAGACAGAGAAGCATTCAAGCTAGCTCCCTGCGCATCAGCAGCACAGGATGAGAATTCTGCGGTTTCGAGCCAGTGCTGTGCTGCAGTGAA GAAGCTTGGGCAGAACCCAGCTTGCCTCTGTGCTGTGATGCTTTCCAATACTGCTAAGAGCTCTGGGGTTAAGCCAGAAGTGGCCATGGCCATCCCCAAA CGCTGCAACATTGCTGACCGTCCCGTGGGTTACAAGTGCGGAGCTTACACATTGCCTTGA
AA sequence Show only first row Show all	>Lus10009872 pacid=23180197 polypeptide=Lus10009872 locus=Lus10009872.g ID=Lus10009872.BGIv1.0 annot-version=v1.0 MAASMKLCICLVGLAVVFGISGFAVEGAGECGKSTNPDREAFKLAPCASAAQDENSAVSSQCCAAVKKLGQNPACLCAVMLSNTAKSSGVKPEVAMAIPK RCNIADRPVGYKCGAYTLP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G05960			Bifunctional inhibitor/lipid-t...		Lus10009872 [exp]	0	1
AT5G24620			Pathogenesis-related thaumatin...		Lus10023896 [exp]	2.8	0.9516
AT2G04305			Magnesium transporter CorA-lik...		Lus10010751 [exp]	4.5	0.9546
AT4G01070		UGT72B1, GT72B1	UDP-GLUCOSE-DEPENDENT GLUCOSYL...		Lus10029452 [exp]	4.9	0.9397
AT4G15760		MO1	monooxygenase 1 (.1.2)		Lus10028081 [exp]	5.0	0.9442
AT1G08170			Histone superfamily protein (....		Lus10041351 [exp]	5.2	0.9474
AT4G33550			Bifunctional inhibitor/lipid-t...		Lus10019029 [exp]	5.3	0.9456
AT1G26140			unknown protein		Lus10035070 [exp]	6.3	0.8917
					Lus10002866 [exp]	6.9	0.8777
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10024584 [exp]	9.5	0.9275
AT4G16400			unknown protein		Lus10004418 [exp]	10.8	0.8919

Compare expression of checked genes

Lus10009872 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.