Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G16760 89 / 7e-22 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT1G78940 85 / 1e-20 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) AT2G07020 79 / 1e-18 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT3G20200 79 / 2e-18 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT4G31230 76 / 2e-17 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT2G24370 72 / 4e-16 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT5G12000 72 / 5e-16 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT5G35380 69 / 8e-15 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT1G17540 68 / 1e-14 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT1G72760 67 / 2e-14 Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024212 [exp] 149 / 3e-43 AT2G24370 780 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10040573 [exp] 85 / 1e-20 AT2G24370 815 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10021596 [exp] 84 / 4e-20 AT2G24370 828 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10033340 [exp] 81 / 3e-19 AT1G16760 800 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10035712 [exp] 80 / 8e-19 AT1G16760 624 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10037298 [exp] 80 / 9e-19 AT1G16760 820 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10027593 [exp] 80 / 1e-18 AT2G24370 665 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10020185 [exp] 78 / 5e-18 AT2G24370 741 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10026989 [exp] 78 / 5e-18 AT2G24370 1014 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G001900 [exp] 91 / 1e-22 AT1G78940 757 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.004G170943 [exp] 86 / 3e-22 AT1G78940 208 / 1e-63 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.018G146966 [exp] 82 / 5e-22 AT5G12000 100 / 2e-26 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.014G001700 [exp] 87 / 2e-21 AT1G78940 783 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.004G170742 [exp] 87 / 2e-21 AT1G78940 786 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.018G002400 [exp] 82 / 1e-19 AT2G24370 956 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.006G078500 [exp] 80 / 9e-19 AT2G24370 824 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.018G061600 [exp] 77 / 5e-18 AT5G12000 714 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.001G198300 [exp] 76 / 3e-17 AT5G12000 639 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.006G225300 [exp] 70 / 3e-15 AT5G12000 749 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009895 pacid=23150098 polypeptide=Lus10009895 locus=Lus10009895.g ID=Lus10009895.BGIv1.0 annot-version=v1.0 ATGTTGGATCAGGATGTGCCCGATTGGCCGGTGGAGGAGGCGCTGAAGCTGGCGAAATTGGGGATCCAGTGTGCGGAATTGAGGAGGAAAGATAGGCCGG ATCTTAAGGAAGTTCTTCTGCCGGAGCTTAGTAGGTTGAGGGCGCTTGCGGAGGAGAAAATGGCTTGCTTGTATTTCGCCGGCGGGGGCGCTGCCGGGGC GCAGTTTCAGAGCTACGTGAGTGAGGAGGTTATGTCTGGGTACGATAGCTCCAGGAGCCGGGCTTCTAGCACGTCGTCGTTTTATGGGGGACAAAGCTGA
AA sequence Show only first row Show all	>Lus10009895 pacid=23150098 polypeptide=Lus10009895 locus=Lus10009895.g ID=Lus10009895.BGIv1.0 annot-version=v1.0 MLDQDVPDWPVEEALKLAKLGIQCAELRRKDRPDLKEVLLPELSRLRALAEEKMACLYFAGGGAAGAQFQSYVSEEVMSGYDSSRSRASSTSSFYGGQS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G16760			Protein kinase protein with ad...		Lus10009895 [exp]	0	1
AT4G33940			RING/U-box superfamily protein...		Lus10012062 [exp]	6.8	0.8297
AT1G43700	bZIP	SUE3, AtbZIP51,...	sulphate utilization efficienc...		Lus10042802 [exp]	11.8	0.7461
AT3G62770		ATATG18A	autophagy 18a, Transducin/WD40...		Lus10041353 [exp]	12.5	0.8117
AT5G40470			RNI-like superfamily protein (...		Lus10002515 [exp]	12.8	0.7983
AT3G04350			Plant protein of unknown funct...		Lus10027952 [exp]	20.6	0.8166
AT1G43700	bZIP	SUE3, AtbZIP51,...	sulphate utilization efficienc...		Lus10029773 [exp]	21.8	0.7369
AT4G12300		CYP706A4	"cytochrome P450, family 706, ...		Lus10032223 [exp]	28.0	0.7810
AT1G11050			Protein kinase superfamily pro...		Lus10012701 [exp]	31.1	0.7636
AT5G17850			Sodium/calcium exchanger famil...		Lus10013634 [exp]	31.2	0.7778
AT1G01500			Erythronate-4-phosphate dehydr...		Lus10036394 [exp]	32.5	0.7403

Compare expression of checked genes

Lus10009895 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.