Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14540 99 / 1e-26 Peroxidase superfamily protein (.1) AT5G05340 97 / 3e-26 Peroxidase superfamily protein (.1) AT1G14550 91 / 1e-23 Peroxidase superfamily protein (.1) AT5G58400 87 / 2e-22 Peroxidase superfamily protein (.1) AT5G58390 77 / 2e-18 Peroxidase superfamily protein (.1) AT2G38390 71 / 3e-16 Peroxidase superfamily protein (.1) AT2G38380 64 / 5e-14 Peroxidase superfamily protein (.1) AT5G06730 64 / 1e-13 Peroxidase superfamily protein (.1) AT3G50990 62 / 2e-13 Peroxidase superfamily protein (.1) AT5G06720 62 / 3e-13 ATPA2 peroxidase 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000003 [exp] 137 / 2e-44 AT1G14540 99 / 1e-26 Peroxidase superfamily protein (.1) Lus10024205 [exp] 134 / 2e-42 AT1G14550 212 / 3e-69 Peroxidase superfamily protein (.1) Lus10024209 [exp] 135 / 2e-40 AT1G14550 432 / 3e-153 Peroxidase superfamily protein (.1) Lus10030148 [exp] 100 / 1e-27 AT5G05340 410 / 3e-145 Peroxidase superfamily protein (.1) Lus10009898 [exp] 99 / 6e-27 AT1G14550 448 / 1e-159 Peroxidase superfamily protein (.1) Lus10009900 [exp] 99 / 8e-27 AT1G14550 436 / 1e-154 Peroxidase superfamily protein (.1) Lus10030149 [exp] 99 / 1e-26 AT5G05340 405 / 8e-142 Peroxidase superfamily protein (.1) Lus10009933 [exp] 99 / 1e-26 AT5G05340 364 / 2e-126 Peroxidase superfamily protein (.1) Lus10009902 [exp] 98 / 2e-26 AT1G14550 441 / 8e-157 Peroxidase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G458700 [exp] 116 / 2e-33 AT1G14540 394 / 4e-138 Peroxidase superfamily protein (.1) Potri.001G458900 [exp] 110 / 3e-31 AT1G14540 389 / 3e-136 Peroxidase superfamily protein (.1) Potri.010G236850 [exp] 108 / 2e-30 AT1G14550 404 / 5e-142 Peroxidase superfamily protein (.1) Potri.010G236910 [exp] 108 / 2e-30 AT1G14550 404 / 5e-142 Peroxidase superfamily protein (.1) Potri.010G236870 [exp] 106 / 7e-30 AT1G14550 409 / 3e-144 Peroxidase superfamily protein (.1) Potri.010G236890 [exp] 106 / 7e-30 AT1G14550 417 / 3e-147 Peroxidase superfamily protein (.1) Potri.010G236900 [exp] 104 / 5e-29 AT1G14550 407 / 2e-143 Peroxidase superfamily protein (.1) Potri.008G022264 [exp] 100 / 6e-29 AT1G14540 213 / 5e-70 Peroxidase superfamily protein (.1) Potri.008G022700 [exp] 101 / 1e-27 AT1G14540 404 / 4e-142 Peroxidase superfamily protein (.1) Potri.008G022248 [exp] 100 / 2e-27 AT1G14540 404 / 3e-142 Peroxidase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009904 pacid=23150105 polypeptide=Lus10009904 locus=Lus10009904.g ID=Lus10009904.BGIv1.0 annot-version=v1.0 ATGCAGAGGAGGGGGCTACTCCAATCGGATCAGGTGCTTTTCAGCGGCGGTTCCACCGACGGGATAGTGCAAGAGTATAGTAGGAATCCCAGAGTTTTCA CCTCCGATTTCGCGGCTGCTATGGTTCGGATGGGTGATATTGAGCCCTTGACTGGTTCTCAGGGCCAAGTTCGCAGAGTTTGTAGCGTAGCCAACGCCGC CTGA
AA sequence Show only first row Show all	>Lus10009904 pacid=23150105 polypeptide=Lus10009904 locus=Lus10009904.g ID=Lus10009904.BGIv1.0 annot-version=v1.0 MQRRGLLQSDQVLFSGGSTDGIVQEYSRNPRVFTSDFAAAMVRMGDIEPLTGSQGQVRRVCSVANAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G14540			Peroxidase superfamily protein...		Lus10009904 [exp]	0	1
AT1G14540			Peroxidase superfamily protein...		Lus10000003 [exp]	1.0	0.9965
AT4G15560		AtCLA1, DXS, DX...	1-DEOXY-D-XYLULOSE 5-PHOSPHATE...		Lus10012724 [exp]	2.4	0.9922
AT4G31940		CYP82C4	"cytochrome P450, family 82, s...		Lus10003147 [exp]	3.2	0.9865
AT2G47710			Adenine nucleotide alpha hydro...		Lus10006701 [exp]	3.5	0.9855
AT1G68390			Core-2/I-branching beta-1,6-N-...		Lus10005107 [exp]	3.9	0.9888
AT3G19615			unknown protein		Lus10031599 [exp]	6.0	0.9812
AT1G13080		CYP71B2	"cytochrome P450, family 71, s...		Lus10043312 [exp]	6.6	0.9879
					Lus10022008 [exp]	7.3	0.9764
AT1G14550			Peroxidase superfamily protein...		Lus10009900 [exp]	9.8	0.9819
AT1G55570		SKS12	SKU5 similar 12 (.1)		Lus10010338 [exp]	10.6	0.9771

Compare expression of checked genes

Lus10009904 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.