Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G26390 72 / 1e-15 Serine protease inhibitor (SERPIN) family protein (.1) AT1G47710 71 / 2e-15 Serine protease inhibitor (SERPIN) family protein (.1) AT2G14540 71 / 2e-15 ATSRP2 serpin 2 (.1) AT3G45220 71 / 3e-15 Serine protease inhibitor (SERPIN) family protein (.1) AT1G64030 69 / 7e-15 ATSRP3 serpin 3 (.1) AT2G25240 68 / 1e-14 Serine protease inhibitor (SERPIN) family protein (.1) AT2G35580 65 / 2e-13 Serine protease inhibitor (SERPIN) family protein (.1) AT1G62170 62 / 4e-12 Serine protease inhibitor (SERPIN) family protein (.1), Serine protease inhibitor (SERPIN) family protein (.2) AT1G63280 52 / 2e-09 Serine protease inhibitor (SERPIN) family protein (.1) AT1G64010 49 / 7e-08 Serine protease inhibitor (SERPIN) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040926 [exp] 153 / 7e-48 AT1G47710 115 / 2e-30 Serine protease inhibitor (SERPIN) family protein (.1) Lus10019009 [exp] 142 / 5e-42 AT1G47710 209 / 9e-64 Serine protease inhibitor (SERPIN) family protein (.1) Lus10032600 [exp] 84 / 2e-20 AT1G47710 99 / 6e-24 Serine protease inhibitor (SERPIN) family protein (.1) Lus10039336 [exp] 75 / 5e-17 AT2G26390 105 / 2e-25 Serine protease inhibitor (SERPIN) family protein (.1) Lus10032754 [exp] 74 / 1e-16 AT1G47710 487 / 1e-172 Serine protease inhibitor (SERPIN) family protein (.1) Lus10002792 [exp] 73 / 5e-16 AT1G47710 495 / 6e-176 Serine protease inhibitor (SERPIN) family protein (.1) Lus10034364 [exp] 66 / 1e-13 AT1G47710 296 / 4e-97 Serine protease inhibitor (SERPIN) family protein (.1) Lus10019736 [exp] 60 / 7e-13 AT1G64030 52 / 3e-09 serpin 3 (.1) Lus10034362 [exp] 62 / 2e-12 AT1G47710 274 / 1e-89 Serine protease inhibitor (SERPIN) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G036000 [exp] 79 / 2e-18 AT1G47710 476 / 1e-168 Serine protease inhibitor (SERPIN) family protein (.1) Potri.017G100900 [exp] 69 / 8e-15 AT1G47710 337 / 2e-113 Serine protease inhibitor (SERPIN) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00079 [flax] [poplar] Serpin Serpin (serine protease inhibitor)
Representative CDS sequence Show only first row Show all	>Lus10009905 pacid=23150108 polypeptide=Lus10009905 locus=Lus10009905.g ID=Lus10009905.BGIv1.0 annot-version=v1.0 ATGAATTCTTCCACAATGTTAATTTTGGCCAATGCACTCTACTTCGAATGTTACTGTCCTCGCCACCTCTTCTCCTCCTCTGCCACTTCTGATGATGAAT TCTACCTCCTCAATGGCGACAAGGTCACCGTCCCCTTCATGAACAACTCCAGACTCGACTTAAGTTACGCAAGCTTCGATGATTTCAAAGTCCTCCAGCT TCCCTATCAATCATCAAAATCCCGAGACGATAAGAACAAACCCGAATTCTCCATGTACATCTTCCTTGCTCGAGAGCGGGATGGACTTCCTCAGATGCTC CGCAAATACTTTAGCGGCTTGAATCCTGGTCAGGCATTTTCAGAAACACTTGTAGCCTAA
AA sequence Show only first row Show all	>Lus10009905 pacid=23150108 polypeptide=Lus10009905 locus=Lus10009905.g ID=Lus10009905.BGIv1.0 annot-version=v1.0 MNSSTMLILANALYFECYCPRHLFSSSATSDDEFYLLNGDKVTVPFMNNSRLDLSYASFDDFKVLQLPYQSSKSRDDKNKPEFSMYIFLARERDGLPQML RKYFSGLNPGQAFSETLVA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G14540		ATSRP2	serpin 2 (.1)		Lus10009905 [exp]	0	1
AT3G22490			Seed maturation protein (.1)		Lus10015948 [exp]	1.0	0.9099
AT5G27350		SFP1	Major facilitator superfamily ...		Lus10035355 [exp]	2.0	0.8545
AT3G54650		FBL17	RNI-like superfamily protein (...		Lus10018768 [exp]	3.5	0.7567
AT5G62840			Phosphoglycerate mutase family...		Lus10030165 [exp]	3.5	0.7756
AT3G14620		CYP72A8	"cytochrome P450, family 72, s...		Lus10026179 [exp]	8.5	0.7947
AT3G11080		AtRLP35	receptor like protein 35 (.1)		Lus10028053 [exp]	9.7	0.7734
AT1G24540		CYP86C1	"cytochrome P450, family 86, s...		Lus10036880 [exp]	11.4	0.7251
					Lus10025367 [exp]	12.0	0.6883
AT3G13890	MYB	ATMYB26, MS35	MALE STERILE 35, myb domain pr...		Lus10015608 [exp]	13.0	0.7454
AT5G60900		RLK1	receptor-like protein kinase 1...		Lus10004365 [exp]	26.7	0.6674

Compare expression of checked genes

Lus10009905 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.