Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G47710 48 / 2e-07 Serine protease inhibitor (SERPIN) family protein (.1) AT2G26390 41 / 6e-05 Serine protease inhibitor (SERPIN) family protein (.1) AT1G64020 39 / 8e-05 Serine protease inhibitor (SERPIN) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039337 [exp] 126 / 4e-38 ND 42 / 6e-05 Lus10039336 [exp] 121 / 1e-34 AT2G26390 105 / 2e-25 Serine protease inhibitor (SERPIN) family protein (.1) Lus10009949 [exp] 110 / 8e-33 ND 43 / 2e-06 Lus10019009 [exp] 112 / 7e-31 AT1G47710 209 / 9e-64 Serine protease inhibitor (SERPIN) family protein (.1) Lus10032600 [exp] 100 / 6e-27 AT1G47710 99 / 6e-24 Serine protease inhibitor (SERPIN) family protein (.1) Lus10005089 [exp] 62 / 3e-12 AT1G47710 306 / 2e-101 Serine protease inhibitor (SERPIN) family protein (.1) Lus10002792 [exp] 56 / 5e-10 AT1G47710 495 / 6e-176 Serine protease inhibitor (SERPIN) family protein (.1) Lus10032754 [exp] 55 / 7e-10 AT1G47710 487 / 1e-172 Serine protease inhibitor (SERPIN) family protein (.1) Lus10034364 [exp] 51 / 2e-08 AT1G47710 296 / 4e-97 Serine protease inhibitor (SERPIN) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G100900 [exp] 49 / 6e-08 AT1G47710 337 / 2e-113 Serine protease inhibitor (SERPIN) family protein (.1) Potri.014G036000 [exp] 47 / 3e-07 AT1G47710 476 / 1e-168 Serine protease inhibitor (SERPIN) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00079 [flax] [poplar] Serpin Serpin (serine protease inhibitor)
Representative CDS sequence Show only first row Show all	>Lus10009906 pacid=23150091 polypeptide=Lus10009906 locus=Lus10009906.g ID=Lus10009906.BGIv1.0 annot-version=v1.0 ATGGATTTCTCAATCCGTGTTGCTATGGAGACCATTCTCCAAGAACTCGGCACCAAAAAGAGAGGCAGTGCCGGCGATGGTGCAGCCGCCCCGAAAAATA TCGTCATGTCTCCAGCATCACTCGACATCTTGCTTCGTATGTTGGCATGCGGAACCAAAGGCCCAACCCTCAAGCAGTTGCTAAGTTTTCTAGGAGCCAA AGACATCGAAGATCTCAATTCAAAAGCTTCTGCAATGATGGAAGCATTGTGTCTAGCCGCACCGACGGGAATCAATAGTGATCAGGAAAGCCAGCCGGCA ATTGTTTCTCAAGCAAACGCGGTTTGGGTGGACCGGAAATAA
AA sequence Show only first row Show all	>Lus10009906 pacid=23150091 polypeptide=Lus10009906 locus=Lus10009906.g ID=Lus10009906.BGIv1.0 annot-version=v1.0 MDFSIRVAMETILQELGTKKRGSAGDGAAAPKNIVMSPASLDILLRMLACGTKGPTLKQLLSFLGAKDIEDLNSKASAMMEALCLAAPTGINSDQESQPA IVSQANAVWVDRK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G47710			Serine protease inhibitor (SER...		Lus10009906 [exp]	0	1
					Lus10026438 [exp]	2.0	0.8252
AT3G04620		DAN1	D NUCLDUO1-ACTIVATEEIC ACID BI...		Lus10005531 [exp]	4.6	0.8272
					Lus10011908 [exp]	8.3	0.7213
					Lus10000351 [exp]	12.8	0.6695
					Lus10002886 [exp]	14.3	0.6695
AT5G55050			GDSL-like Lipase/Acylhydrolase...		Lus10021543 [exp]	15.7	0.6695
AT5G58660			2-oxoglutarate (2OG) and Fe(II...		Lus10031865 [exp]	16.9	0.6695
					Lus10033059 [exp]	18.1	0.6695
AT3G26880			Plant self-incompatibility pro...		Lus10022631 [exp]	19.2	0.6695
AT3G25050		XTH3	xyloglucan endotransglucosylas...		Lus10022782 [exp]	20.2	0.6695

Compare expression of checked genes

Lus10009906 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.