Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59320 71 / 4e-17 LTP3 lipid transfer protein 3 (.1) AT2G38540 68 / 7e-16 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT3G51600 66 / 4e-15 LTP5 lipid transfer protein 5 (.1) AT5G59310 64 / 2e-14 LTP4 lipid transfer protein 4 (.1) AT4G33355 64 / 4e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G38530 61 / 4e-13 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT2G15050 61 / 5e-13 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3) AT3G51590 61 / 5e-13 LTP12 lipid transfer protein 12 (.1) AT3G08770 61 / 7e-13 LTP6 lipid transfer protein 6 (.1.2) AT5G01870 60 / 1e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024201 [exp] 142 / 2e-45 AT5G59320 57 / 5e-12 lipid transfer protein 3 (.1) Lus10042210 [exp] 115 / 3e-34 AT5G59320 86 / 6e-23 lipid transfer protein 3 (.1) Lus10008606 [exp] 114 / 5e-31 AT5G59320 84 / 3e-19 lipid transfer protein 3 (.1) Lus10022745 [exp] 87 / 6e-23 AT5G59310 103 / 1e-29 lipid transfer protein 4 (.1) Lus10014167 [exp] 86 / 1e-22 AT5G59310 102 / 2e-29 lipid transfer protein 4 (.1) Lus10015279 [exp] 76 / 6e-19 AT5G59320 116 / 6e-35 lipid transfer protein 3 (.1) Lus10026418 [exp] 76 / 8e-19 AT5G59320 115 / 2e-34 lipid transfer protein 3 (.1) Lus10025151 [exp] 75 / 2e-18 AT5G59320 103 / 1e-29 lipid transfer protein 3 (.1) Lus10025234 [exp] 72 / 3e-17 AT2G38530 118 / 2e-35 cell growth defect factor-3, lipid transfer protein 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G086600 [exp] 87 / 4e-23 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.004G086500 [exp] 85 / 2e-22 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G136000 [exp] 71 / 1e-16 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135800 [exp] 69 / 5e-16 AT5G01870 111 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232900 [exp] 67 / 2e-15 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G025200 [exp] 66 / 6e-15 AT2G18370 86 / 6e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232700 [exp] 66 / 9e-15 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135500 [exp] 64 / 2e-14 AT5G59320 94 / 8e-26 lipid transfer protein 3 (.1) Potri.016G135400 [exp] 64 / 2e-14 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.006G108100 [exp] 60 / 2e-12 AT2G38540 121 / 6e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10009911 pacid=23150104 polypeptide=Lus10009911 locus=Lus10009911.g ID=Lus10009911.BGIv1.0 annot-version=v1.0 ATGGCTAATCACAACATCGTCAAGGCAGCAGTGTGCTCACTAATGCTAGCCTGCAGCCTGATCGTAATAGCACCATACGTGAAGGCCGAGATCTCATGCC TGCAGATCACCATGCAGCTGACGCCCTGCATCCCTTATGGGGTGCTGGGAGGGGAAGTTCCAGCGGGATGCTGCCAAGGGGTGAAGGACTCGCTGGCACT TGTGAAGACCACTGAGGATCTGCGGGCGAAATGCCAGTGTGTTAAGGACGGTGCTGCTGGGATCCCGGGACTGAACTACACTAGGGTGAATGAGCTCCCT GCCAAATGTGGAACCAAAGAGCTTTACGTTGTTAGCCCCAACACCGATTGCTCCAAGTAA
AA sequence Show only first row Show all	>Lus10009911 pacid=23150104 polypeptide=Lus10009911 locus=Lus10009911.g ID=Lus10009911.BGIv1.0 annot-version=v1.0 MANHNIVKAAVCSLMLACSLIVIAPYVKAEISCLQITMQLTPCIPYGVLGGEVPAGCCQGVKDSLALVKTTEDLRAKCQCVKDGAAGIPGLNYTRVNELP AKCGTKELYVVSPNTDCSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59320		LTP3	lipid transfer protein 3 (.1)		Lus10009911 [exp]	0	1
AT5G59320		LTP3	lipid transfer protein 3 (.1)		Lus10024201 [exp]	2.2	0.9318
AT1G11300			protein serine/threonine kinas...		Lus10013245 [exp]	2.8	0.8868
AT3G13790		ATCWINV1, ATBFR...	ARABIDOPSIS THALIANA CELL WALL...		Lus10015613 [exp]	6.3	0.8323
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10002393 [exp]	6.9	0.8562
AT4G10270			Wound-responsive family protei...		Lus10031616 [exp]	11.0	0.8161
AT3G14810		MSL5	mechanosensitive channel of sm...		Lus10005632 [exp]	15.9	0.8447
AT2G39440			unknown protein		Lus10018300 [exp]	17.7	0.8694
AT2G39440			unknown protein		Lus10040607 [exp]	18.4	0.8679
AT5G37730			unknown protein		Lus10033584 [exp]	19.5	0.8625
AT2G43820		SGT1, ATSAGT1, ...	UDP-glucose:salicylic acid glu...		Lus10020556 [exp]	19.6	0.8620

Compare expression of checked genes

Lus10009911 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.