Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14190 114 / 7e-31 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) AT1G14185 112 / 2e-30 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) AT5G51950 105 / 9e-28 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1), Glucose-methanol-choline (GMC) oxidoreductase family protein (.2) AT3G56060 91 / 2e-22 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) AT5G51930 86 / 6e-21 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) AT1G72970 83 / 8e-20 HTH, EDA17 HOTHEAD, embryo sac development arrest 17, Glucose-methanol-choline (GMC) oxidoreductase family protein (.1), Glucose-methanol-choline (GMC) oxidoreductase family protein (.2) AT1G12570 81 / 6e-19 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) AT1G73050 78 / 4e-18 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030456 [exp] 150 / 4e-44 AT1G14185 634 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) Lus10030459 [exp] 142 / 5e-41 AT1G14185 605 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) Lus10030463 [exp] 139 / 5e-40 AT1G14185 504 / 5e-176 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) Lus10026607 [exp] 136 / 6e-39 AT1G14185 605 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) Lus10030457 [exp] 135 / 1e-38 AT1G14185 589 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) Lus10032641 [exp] 131 / 5e-37 AT1G14185 608 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) Lus10012816 [exp] 130 / 5e-37 AT1G14190 539 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) Lus10032347 [exp] 126 / 7e-37 AT1G14185 308 / 2e-102 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) Lus10026606 [exp] 126 / 2e-35 AT1G14190 554 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G168200 [exp] 134 / 3e-38 AT1G14190 598 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) Potri.008G087400 [exp] 130 / 6e-37 AT1G14185 639 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) Potri.010G168100 [exp] 129 / 1e-36 AT1G14185 654 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) Potri.001G111500 [exp] 89 / 8e-22 AT1G12570 773 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) Potri.001G200800 [exp] 87 / 3e-21 AT1G72970 831 / 0.0 HOTHEAD, embryo sac development arrest 17, Glucose-methanol-choline (GMC) oxidoreductase family protein (.1), Glucose-methanol-choline (GMC) oxidoreductase family protein (.2) Potri.008G009600 [exp] 85 / 2e-20 AT1G73050 785 / 0.0 Glucose-methanol-choline (GMC) oxidoreductase family protein (.1) Potri.003G039000 [exp] 82 / 3e-19 AT1G72970 808 / 0.0 HOTHEAD, embryo sac development arrest 17, Glucose-methanol-choline (GMC) oxidoreductase family protein (.1), Glucose-methanol-choline (GMC) oxidoreductase family protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05199 [flax] [poplar] GMC_oxred_C GMC oxidoreductase
Representative CDS sequence Show only first row Show all	>Lus10009914 pacid=23150144 polypeptide=Lus10009914 locus=Lus10009914.g ID=Lus10009914.BGIv1.0 annot-version=v1.0 ATGGATGGATGTGTCGAGATGGTCAAGTTGTTGATGAAAGTTGCCAACACTCGATCCGTGGAGACGTTCCTGAAGGCCGATGGAAGTATTCATGACGACA ATTCCACGATAACTTCGTATCCTGACGAGCTGCGGAATTTCTGCAGGAGGAATTTGAGGACTCTTTACCGTTATCATGGCGGGTGTGGGGTCGGATCAGT TGTTGGTAAAGATTATAGACTGTTTGGTGTTGAAGGTTTGAGAGTTGTTGATGGGTCGACTTTCCTCGAGTGTCTTGGCACGAATCCGATGGCTACTGTT CTGATGCTTGGTAGATATCAAGATACTTGCTGA
AA sequence Show only first row Show all	>Lus10009914 pacid=23150144 polypeptide=Lus10009914 locus=Lus10009914.g ID=Lus10009914.BGIv1.0 annot-version=v1.0 MDGCVEMVKLLMKVANTRSVETFLKADGSIHDDNSTITSYPDELRNFCRRNLRTLYRYHGGCGVGSVVGKDYRLFGVEGLRVVDGSTFLECLGTNPMATV LMLGRYQDTC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G14190			Glucose-methanol-choline (GMC)...		Lus10009914 [exp]	0	1
AT5G16920			Fasciclin-like arabinogalactan...		Lus10013786 [exp]	1.4	0.8956
AT2G26250		KCS10, FDH	FIDDLEHEAD, 3-ketoacyl-CoA syn...		Lus10028105 [exp]	6.7	0.8326
AT5G16080		ATCXE17	carboxyesterase 17 (.1)		Lus10033548 [exp]	7.5	0.8180
AT2G34930			disease resistance family prot...		Lus10001035 [exp]	8.1	0.8637
AT5G16990			Zinc-binding dehydrogenase fam...		Lus10030085 [exp]	9.5	0.8273
AT5G53110			RING/U-box superfamily protein...		Lus10025491 [exp]	9.5	0.8264
					Lus10014515 [exp]	10.0	0.8429
AT5G22260		MS1	male sterility 1, RING/FYVE/PH...		Lus10013251 [exp]	11.0	0.8120
AT3G13400		SKS13	SKU5 similar 13 (.1)		Lus10036492 [exp]	11.6	0.7834
					Lus10004778 [exp]	13.0	0.8466

Compare expression of checked genes

Lus10009914 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.