Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G60900 92 / 1e-23 RLK1 receptor-like protein kinase 1 (.1) AT2G41890 68 / 7e-15 curculin-like (mannose-binding) lectin family protein / PAN domain-containing protein (.1) AT1G34300 65 / 6e-14 lectin protein kinase family protein (.1) AT2G19130 57 / 3e-11 S-locus lectin protein kinase family protein (.1) AT5G24080 57 / 6e-11 Protein kinase superfamily protein (.1) AT1G53430 57 / 6e-11 Leucine-rich repeat transmembrane protein kinase (.1.2) AT1G29730 55 / 2e-10 Leucine-rich repeat transmembrane protein kinase (.1) AT1G53440 55 / 2e-10 Leucine-rich repeat transmembrane protein kinase (.1) AT1G60800 52 / 2e-09 NIK3 NSP-interacting kinase 3 (.1) AT1G70740 51 / 6e-09 Protein kinase superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018251 [exp] 151 / 2e-48 AT5G60900 213 / 2e-65 receptor-like protein kinase 1 (.1) Lus10030400 [exp] 124 / 3e-35 AT5G60900 356 / 1e-115 receptor-like protein kinase 1 (.1) Lus10031805 [exp] 112 / 1e-30 AT5G60900 530 / 5e-178 receptor-like protein kinase 1 (.1) Lus10031231 [exp] 112 / 2e-30 AT5G60900 536 / 2e-180 receptor-like protein kinase 1 (.1) Lus10024195 [exp] 102 / 6e-27 AT5G60900 367 / 3e-114 receptor-like protein kinase 1 (.1) Lus10024197 [exp] 86 / 7e-24 AT5G60900 67 / 3e-15 receptor-like protein kinase 1 (.1) Lus10031230 [exp] 81 / 2e-19 AT5G60900 388 / 4e-123 receptor-like protein kinase 1 (.1) Lus10004365 [exp] 77 / 5e-18 AT5G60900 545 / 0.0 receptor-like protein kinase 1 (.1) Lus10031804 [exp] 71 / 4e-16 AT5G60900 234 / 2e-71 receptor-like protein kinase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T085100 [exp] 108 / 5e-29 AT5G60900 554 / 0.0 receptor-like protein kinase 1 (.1) Potri.T084701 [exp] 102 / 4e-27 AT5G60900 550 / 0.0 receptor-like protein kinase 1 (.1) Potri.003G211800 [exp] 101 / 9e-27 AT5G60900 550 / 0.0 receptor-like protein kinase 1 (.1) Potri.T085000 [exp] 98 / 2e-25 AT5G60900 559 / 0.0 receptor-like protein kinase 1 (.1) Potri.003G211532 [exp] 92 / 2e-25 AT5G60900 164 / 1e-47 receptor-like protein kinase 1 (.1) Potri.003G211366 [exp] 96 / 7e-25 AT5G60900 568 / 0.0 receptor-like protein kinase 1 (.1) Potri.003G211700 [exp] 94 / 3e-24 AT5G60900 527 / 5e-177 receptor-like protein kinase 1 (.1) Potri.003G211866 [exp] 93 / 4e-24 AT5G60900 346 / 4e-113 receptor-like protein kinase 1 (.1) Potri.T085150 [exp] 93 / 9e-24 AT5G60900 554 / 0.0 receptor-like protein kinase 1 (.1) Potri.T084601 [exp] 93 / 1e-23 AT5G60900 519 / 3e-174 receptor-like protein kinase 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009916 pacid=23150102 polypeptide=Lus10009916 locus=Lus10009916.g ID=Lus10009916.BGIv1.0 annot-version=v1.0 ATGCTTGCAGAGTGGGCATATGAATGCTACAGTCAAGGTCAGTTGAAGAGGCTCGTGAATGACGATGTGGAGGCAATGGCTGACATGGGGAAAGTCGAGA GATTCGTTAAGGTTGCATTCTGGTGCATTCAACACGATTCAACAATGAGGCCTGCAATGAAGAAAGTTGTTCATATGCTGGAAGGATCTGTCCATGTCTC TCCGCCTCTAGATCCAGATTCCTTCATCACCAGTATATGA
AA sequence Show only first row Show all	>Lus10009916 pacid=23150102 polypeptide=Lus10009916 locus=Lus10009916.g ID=Lus10009916.BGIv1.0 annot-version=v1.0 MLAEWAYECYSQGQLKRLVNDDVEAMADMGKVERFVKVAFWCIQHDSTMRPAMKKVVHMLEGSVHVSPPLDPDSFITSI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G60900		RLK1	receptor-like protein kinase 1...		Lus10009916 [exp]	0	1
AT1G30500	CCAAT	NF-YA7	"nuclear factor Y, subunit A7"...		Lus10012202 [exp]	2.4	0.9418
AT5G57500			Galactosyltransferase family p...		Lus10000372 [exp]	3.0	0.9380
AT4G10970			unknown protein		Lus10023075 [exp]	3.3	0.9427
AT5G22050			Protein kinase superfamily pro...		Lus10004110 [exp]	4.9	0.9336
AT2G26430		ATRCY1, RCY1	arginine-rich cyclin 1 (.1.2.3...		Lus10036509 [exp]	5.7	0.9296
AT3G23770			O-Glycosyl hydrolases family 1...		Lus10023226 [exp]	6.3	0.9352
AT2G14255			Ankyrin repeat family protein ...		Lus10040833 [exp]	6.5	0.9260
AT1G14740			Protein of unknown function (D...		Lus10030769 [exp]	7.3	0.9327
AT2G17070			Arabidopsis protein of unknown...		Lus10007109 [exp]	7.6	0.9036
AT2G32080		PUR ALPHA-1, PU...	purin-rich alpha 1 (.1.2)		Lus10020245 [exp]	9.8	0.9357

Compare expression of checked genes

Lus10009916 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.