Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G17730 62 / 5e-12 NAC ANAC057 NAC domain containing protein 57 (.1) AT3G04070 60 / 5e-11 NAC ANAC047 NAC domain containing protein 47 (.1.2) AT1G65910 60 / 9e-11 NAC ANAC028 NAC domain containing protein 28 (.1) AT1G61110 59 / 2e-10 NAC ANAC025 NAC domain containing protein 25 (.1) AT3G15500 58 / 3e-10 NAC ATNAC3, ANAC055 NAC domain containing protein 55, NAC domain containing protein 3 (.1) AT5G46590 57 / 4e-10 NAC ANAC096 NAC domain containing protein 96 (.1) AT1G54330 57 / 7e-10 NAC ANAC020 NAC domain containing protein 20 (.1) AT1G52890 57 / 7e-10 NAC ANAC019 NAC domain containing protein 19 (.1) AT5G17260 56 / 1e-09 NAC ANAC086 NAC domain containing protein 86 (.1) AT1G77450 56 / 1e-09 NAC ANAC032 NAC domain containing protein 32 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036959 [exp] 110 / 9e-31 AT3G04070 82 / 8e-19 NAC domain containing protein 47 (.1.2) Lus10037106 [exp] 107 / 1e-29 AT3G04070 78 / 3e-17 NAC domain containing protein 47 (.1.2) Lus10036955 [exp] 81 / 2e-19 AT3G15510 52 / 2e-08 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10022914 [exp] 62 / 3e-12 AT1G61110 54 / 7e-09 NAC domain containing protein 25 (.1) Lus10032657 [exp] 63 / 9e-12 AT3G15510 353 / 1e-120 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10043095 [exp] 62 / 1e-11 AT3G15510 351 / 1e-119 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10024907 [exp] 60 / 1e-11 AT5G62380 52 / 3e-08 VASCULAR-RELATED NAC-DOMAIN 6, NAC-domain protein 101 (.1) Lus10026617 [exp] 61 / 2e-11 AT1G69490 298 / 1e-101 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Lus10026496 [exp] 61 / 3e-11 AT1G61110 244 / 6e-79 NAC domain containing protein 25 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G038000 [exp] 66 / 7e-13 AT1G61110 332 / 3e-113 NAC domain containing protein 25 (.1) Potri.011G123500 [exp] 63 / 8e-12 AT3G15510 323 / 4e-109 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.001G256600 [exp] 63 / 8e-12 AT3G04070 190 / 7e-56 NAC domain containing protein 47 (.1.2) Potri.001G404400 [exp] 62 / 1e-11 AT3G15510 345 / 1e-117 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.015G030200 [exp] 62 / 1e-11 AT3G17730 374 / 6e-133 NAC domain containing protein 57 (.1) Potri.011G046700 [exp] 62 / 1e-11 AT1G61110 331 / 8e-113 NAC domain containing protein 25 (.1) Potri.005G180200 [exp] 61 / 3e-11 AT1G01720 392 / 9e-139 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.002G081000 [exp] 61 / 4e-11 AT1G01720 416 / 5e-148 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.012G038100 [exp] 60 / 7e-11 AT3G17730 339 / 4e-118 NAC domain containing protein 57 (.1) Potri.010G174600 [exp] 60 / 8e-11 AT1G54330 290 / 2e-97 NAC domain containing protein 20 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10009924 pacid=23150121 polypeptide=Lus10009924 locus=Lus10009924.g ID=Lus10009924.BGIv1.0 annot-version=v1.0 ATGAAGATCCCCGGCCTGCCGCTGGGCTACCGATTTGAGCCATCCGACTCCGACCTAATCCTCAACTACCTCTACCCTAAAGCCACGTCATCCAACAGCT ACCAAGACTTCATCCCCGAGTGCGACCTTTACGACGTCCAAGAATCTTGGAAGCGCTACTTCCACGGCGGGGAGACAGAGATGTACTTCTACACCAAGCT CAAGAGGAAGAAAACCGAAAAGAACGGCCACCATATGGAGAGGGGCTACGGGGGACGCGTGTGGAAGTCTCAGAAGGAGGATTTGGTGTACTACACTGAC AACGAAGGGAAGAAGACGAAGATGAGGTCGAGGAGGTCGTTCTCGTACAAGGTTACAGATGGTTACGGGGAGGGTACGGGGGATAATAGTAATGATGAGT GGGTGATGCATGAGTTTCGTCTTGGTGAAGTATTGGGTGGAGGGAAGAGTAAGGAGAGTGATCAGTTTGCATGGGTGTTCTATAGCATGGTGTACATAGT TTATGATTGTTTGCATGGGTGTTCTATAGCTACGTAG
AA sequence Show only first row Show all	>Lus10009924 pacid=23150121 polypeptide=Lus10009924 locus=Lus10009924.g ID=Lus10009924.BGIv1.0 annot-version=v1.0 MKIPGLPLGYRFEPSDSDLILNYLYPKATSSNSYQDFIPECDLYDVQESWKRYFHGGETEMYFYTKLKRKKTEKNGHHMERGYGGRVWKSQKEDLVYYTD NEGKKTKMRSRRSFSYKVTDGYGEGTGDNSNDEWVMHEFRLGEVLGGGKSKESDQFAWVFYSMVYIVYDCLHGCSIAT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G04070	NAC	ANAC047	NAC domain containing protein ...		Lus10009924 [exp]	0	1
AT5G17680			disease resistance protein (TI...		Lus10028043 [exp]	1.0	0.9428
AT1G06645			2-oxoglutarate (2OG) and Fe(II...		Lus10033876 [exp]	2.0	0.8586
AT1G14190			Glucose-methanol-choline (GMC)...		Lus10026606 [exp]	4.2	0.7937
					Lus10021816 [exp]	11.7	0.8439
					Lus10013963 [exp]	13.0	0.8464
					Lus10025503 [exp]	15.5	0.8166
AT2G36540			Haloacid dehalogenase-like hyd...		Lus10019760 [exp]	19.9	0.8013
AT1G15460		ATBOR4	ARABIDOPSIS THALIANA REQUIRES ...		Lus10013116 [exp]	21.0	0.7336
					Lus10011928 [exp]	24.2	0.7919
AT3G50845			Protein of unknown function (D...		Lus10014311 [exp]	25.1	0.8008

Compare expression of checked genes

Lus10009924 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.