Plant FIBer expression Database

Lus10009931 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G35780 72 / 7e-17 unknown protein
AT1G78150 69 / 1e-15 unknown protein
AT4G39860 64 / 1e-13 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020921
[exp]
85 / 1e-21 AT1G35780 367 / 1e-128 unknown protein
Lus10033456
[exp]
82 / 2e-20 AT1G35780 362 / 1e-126 unknown protein
Lus10041695
[exp]
61 / 2e-12 AT4G39860 399 / 1e-140 unknown protein
Lus10024053
[exp]
60 / 3e-12 AT4G39870 416 / 2e-137 TLD-domain containing nucleolar protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G095300
[exp]
70 / 4e-16 AT1G35780 364 / 2e-127 unknown protein
Potri.005G165500
[exp]
70 / 5e-16 AT1G35780 357 / 2e-124 unknown protein
Potri.005G076000
[exp]
58 / 1e-11 AT4G39860 354 / 3e-123 unknown protein
Potri.007G092400
[exp]
53 / 6e-10 AT4G39860 384 / 4e-135 unknown protein
PFAM info
Representative CDS sequence
>Lus10009931 pacid=23150141 polypeptide=Lus10009931 locus=Lus10009931.g ID=Lus10009931.BGIv1.0 annot-version=v1.0
ATGGAGCGGAACACACCGGTGAGGAAGCCCCACAATTCCACTGCAGATCTGCTCACTTGGTCCGAGACTCCACCTCCTGAATCTCCCTCACTCTCCTCCG
CTCCTCGCTCCGCCGCAAGATCCCACCAACCGTCGGATGGAATCAGCAAGGTTGTGTTTGGTGGTCAGGTGACTGACGAAGAATCTGTCAGTCTTAACAA
ACGGTGA
AA sequence
>Lus10009931 pacid=23150141 polypeptide=Lus10009931 locus=Lus10009931.g ID=Lus10009931.BGIv1.0 annot-version=v1.0
MERNTPVRKPHNSTADLLTWSETPPPESPSLSSAPRSAARSHQPSDGISKVVFGGQVTDEESVSLNKR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G35780 unknown protein Lus10009931
[exp]
0 1
AT1G69420 DHHC-type zinc finger family p... Lus10036798
[exp]
1.4 0.8819
AT5G54390 ATAHL, AHL HAL2-like (.1) Lus10038597
[exp]
5.3 0.8452
AT1G69420 DHHC-type zinc finger family p... Lus10037133
[exp]
5.5 0.8572
AT1G74690 IQD31 IQ-domain 31 (.1) Lus10004263
[exp]
5.5 0.8576
AT2G30710 Ypt/Rab-GAP domain of gyp1p su... Lus10019369
[exp]
8.8 0.7819
AT3G48750 CDKA1, CDC2A, C... cell division control 2 (.1) Lus10038754
[exp]
8.8 0.8368
AT5G52540 Protein of unknown function (D... Lus10027508
[exp]
11.3 0.8309
AT2G40980 Protein kinase superfamily pro... Lus10015685
[exp]
11.5 0.8242
AT4G27060 CN, SPR2, TOR1 TORTIFOLIA 1, SPIRAL 2, CONVOL... Lus10011149
[exp]
13.7 0.8252
AT2G34710 HD ATHB14, PHB-1D,... PHABULOSA 1D, PHABULOSA, ARABI... Lus10038449
[exp]
15.5 0.8128

Lus10009931 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.