Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G46990 119 / 8e-35 AUX_IAA IAA20 indole-3-acetic acid inducible 20 (.1) AT3G62100 119 / 8e-35 AUX_IAA IAA30 indole-3-acetic acid inducible 30 (.1) AT3G17600 106 / 6e-30 AUX_IAA IAA31 indole-3-acetic acid inducible 31 (.1) AT2G33310 92 / 1e-23 AUX_IAA IAA13 auxin-induced protein 13 (.1.2.3) AT4G28640 91 / 6e-23 AUX_IAA IAA11 indole-3-acetic acid inducible 11 (.1.2.3) AT1G04550 89 / 3e-22 AUX_IAA BDL, IAA12 indole-3-acetic acid inducible 12, BODENLOS, AUX/IAA transcriptional regulator family protein (.1.2) AT5G25890 85 / 2e-21 AUX_IAA IAR2, IAA28 IAA-ALANINE RESISTANT 2, indole-3-acetic acid inducible 28 (.1) AT3G16500 85 / 2e-20 AUX_IAA IAA26, PAP1 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1) AT1G51950 83 / 7e-20 AUX_IAA IAA18 indole-3-acetic acid inducible 18 (.1) AT5G65670 81 / 8e-19 AUX_IAA IAA9 indole-3-acetic acid inducible 9 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038025 [exp] 228 / 9e-78 AT3G62100 127 / 1e-37 indole-3-acetic acid inducible 30 (.1) Lus10007193 [exp] 164 / 1e-52 AT3G62100 117 / 4e-34 indole-3-acetic acid inducible 30 (.1) Lus10010081 [exp] 162 / 6e-52 AT2G46990 115 / 4e-33 indole-3-acetic acid inducible 20 (.1) Lus10014464 [exp] 92 / 6e-23 AT2G33310 231 / 4e-75 auxin-induced protein 13 (.1.2.3) Lus10023719 [exp] 91 / 2e-22 AT2G33310 223 / 4e-72 auxin-induced protein 13 (.1.2.3) Lus10022868 [exp] 89 / 9e-22 AT4G28640 198 / 1e-62 indole-3-acetic acid inducible 11 (.1.2.3) Lus10038285 [exp] 84 / 6e-20 AT3G16500 224 / 3e-72 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1) Lus10024853 [exp] 82 / 8e-20 AT1G04240 216 / 1e-71 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10039413 [exp] 82 / 8e-20 AT1G04240 250 / 2e-85 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G111700 [exp] 147 / 1e-45 AT3G62100 150 / 7e-47 indole-3-acetic acid inducible 30 (.1) Potri.002G186400 [exp] 139 / 9e-43 AT3G62100 147 / 3e-45 indole-3-acetic acid inducible 30 (.1) Potri.013G041300 [exp] 87 / 5e-22 AT5G43700 239 / 5e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.010G065200 [exp] 89 / 9e-22 AT2G33310 243 / 4e-80 auxin-induced protein 13 (.1.2.3) Potri.008G172400 [exp] 88 / 1e-21 AT2G33310 246 / 4e-81 auxin-induced protein 13 (.1.2.3) Potri.003G048100 [exp] 88 / 2e-21 AT3G16500 224 / 4e-72 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1) Potri.001G190300 [exp] 87 / 3e-21 AT3G16500 235 / 3e-76 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1) Potri.006G255200 [exp] 85 / 9e-21 AT4G32280 137 / 7e-40 indole-3-acetic acid inducible 29 (.1) Potri.006G236200 [exp] 86 / 2e-20 AT3G16500 184 / 3e-56 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1) Potri.005G053800 [exp] 83 / 3e-20 AT5G43700 239 / 7e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF02309 [flax] [poplar] AUX_IAA AUX/IAA family
Representative CDS sequence Show only first row Show all	>Lus10009967 pacid=23176713 polypeptide=Lus10009967 locus=Lus10009967.g ID=Lus10009967.BGIv1.0 annot-version=v1.0 ATGTCTCATCACAAAAGGCACCGGAGAGACCTCACCACCGATCTCCGGCTCGGCCTCAGCAACAACTCTGGCGGCTGCGATGAAATGGAGTACGGAAACA ACAACAACAACAACCACAACCATGGTGGTGGTGGTGGTGGTGCTACTTTCTTTGTGAAAGTGTATATGGAAGGCATCCCAATTGGGAGGAAGTTGGACTT GTTGGCTTATGATTCTTATGAAGACATGATCTCCACTCTTGATGCCATGTTTGGCACTAACATTCTTTGGGATGAGATGGAAAGTGACCAGAGCAATTAC AATGGACAAGTGCAGTACCATGTGTTGACTTATGAAGACAAAGAAGGAGATTGGTTAATTGTTGGAGATGTTCCATGGGAGGTGTTTGTGTCCTGTGTGA AGAGACTGAAGATAACCAGAGCAGATAGCTTGTGA
AA sequence Show only first row Show all	>Lus10009967 pacid=23176713 polypeptide=Lus10009967 locus=Lus10009967.g ID=Lus10009967.BGIv1.0 annot-version=v1.0 MSHHKRHRRDLTTDLRLGLSNNSGGCDEMEYGNNNNNNHNHGGGGGGATFFVKVYMEGIPIGRKLDLLAYDSYEDMISTLDAMFGTNILWDEMESDQSNY NGQVQYHVLTYEDKEGDWLIVGDVPWEVFVSCVKRLKITRADSL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G62100	AUX_IAA	IAA30	indole-3-acetic acid inducible...		Lus10009967 [exp]	0	1
AT1G71140			MATE efflux family protein (.1...		Lus10006171 [exp]	8.1	0.6589
AT4G12110		ATSMO1-1, SMO1-...	sterol-4alpha-methyl oxidase 1...		Lus10032193 [exp]	9.3	0.7123
AT1G68350			unknown protein		Lus10041431 [exp]	15.0	0.6610
AT1G68350			unknown protein		Lus10013533 [exp]	16.6	0.6599
AT5G53550		ATYSL3, YSL3	YELLOW STRIPE like 3 (.1.2)		Lus10012053 [exp]	18.4	0.6758
AT5G63810		BGAL10	beta-galactosidase 10 (.1)		Lus10025108 [exp]	23.6	0.6970
AT5G60440	MADS	AGL62	AGAMOUS-like 62 (.1)		Lus10025872 [exp]	29.2	0.6601
					Lus10006631 [exp]	34.6	0.6428
AT3G33520		SUF3, ESD1, ATA...	SUPPRESSOR OF FRI 3, EARLY IN ...		Lus10006654 [exp]	38.2	0.6617
AT4G12110		ATSMO1-1, SMO1-...	sterol-4alpha-methyl oxidase 1...		Lus10024555 [exp]	54.9	0.6598

Compare expression of checked genes

Lus10009967 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.