Lus10009981 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G62190 102 / 7e-29 Chaperone DnaJ-domain superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038040 188 / 6e-61 AT3G62190 110 / 2e-30 Chaperone DnaJ-domain superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G188300 139 / 3e-43 AT3G62190 171 / 4e-56 Chaperone DnaJ-domain superfamily protein (.1.2)
Potri.010G035000 40 / 0.0002 AT1G10350 429 / 1e-151 DNAJ heat shock family protein (.1)
Potri.008G194000 40 / 0.0003 AT1G10350 402 / 4e-141 DNAJ heat shock family protein (.1)
Potri.009G131800 37 / 0.0008 AT2G17880 109 / 9e-32 Chaperone DnaJ-domain superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0392 Chaperone-J PF00226 DnaJ DnaJ domain
Representative CDS sequence
>Lus10009981 pacid=23176706 polypeptide=Lus10009981 locus=Lus10009981.g ID=Lus10009981.BGIv1.0 annot-version=v1.0
ATGGTGGGAGACGAAGCCAGAGTCTTGCTAGGCTTCCCTCCCAATTCCACCCCAACCATCTCCCAGGTTAAAGCTGCTTACAAGAAGAAGGTTTGGGAAT
CGCATCCTGACTTGTTCCCAGTTCATGACAAGTGCCGTGCTGAGTCCCAGTTTAAATTGGTTTCAGAGGCTTATACTCACCTCCTATCTGGGGGACTTGG
AACCGTCCATGACTTTTCCGATTCAGCAGCCAGATACGCTCGTGTAGTCGTCAGAGCAGGAGTACCAAAGGGACCAACGGGGAGGAACGAACTCCGGAGG
CTTTGGATTCCGTTTCTATTCCTTGTTGGAGGGACGATTGGACTAGGAGGTTTCATCGGCACCAGGGCTTACAAGAGGCAGAAAGAAGCATTTCCTTCAC
ACAACCCTTTTCTTCCTTGA
AA sequence
>Lus10009981 pacid=23176706 polypeptide=Lus10009981 locus=Lus10009981.g ID=Lus10009981.BGIv1.0 annot-version=v1.0
MVGDEARVLLGFPPNSTPTISQVKAAYKKKVWESHPDLFPVHDKCRAESQFKLVSEAYTHLLSGGLGTVHDFSDSAARYARVVVRAGVPKGPTGRNELRR
LWIPFLFLVGGTIGLGGFIGTRAYKRQKEAFPSHNPFLP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G62190 Chaperone DnaJ-domain superfam... Lus10009981 0 1
AT2G04845 Acyl-CoA N-acyltransferases (N... Lus10012349 5.5 0.7966
AT4G31540 ATEXO70G1 exocyst subunit exo70 family p... Lus10014917 52.8 0.7217
AT4G31810 ATP-dependent caseinolytic (Cl... Lus10042883 56.9 0.7610
AT4G31750 WIN2 HOPW1-1-interacting 2 (.1) Lus10020104 60.6 0.7706
AT5G45030 Trypsin family protein (.1.2) Lus10017140 71.7 0.7160
AT1G14820 Sec14p-like phosphatidylinosit... Lus10003699 77.0 0.7552
AT3G11210 SGNH hydrolase-type esterase s... Lus10004815 94.7 0.7338
AT4G32340 Tetratricopeptide repeat (TPR)... Lus10002013 105.6 0.6963
AT4G00500 alpha/beta-Hydrolases superfam... Lus10037847 120.2 0.7292
AT3G22142 Bifunctional inhibitor/lipid-t... Lus10033214 124.7 0.6974

Lus10009981 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.