Plant FIBer expression Database

Lus10010001 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G47270 42 / 6e-06 bHLH bHLH151, UPB1 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001447
[exp]
49 / 2e-08 AT2G47270 69 / 2e-16 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1)
Lus10002419
[exp]
48 / 3e-08 AT2G47270 67 / 4e-16 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G193300
[exp]
43 / 4e-06 AT2G47270 79 / 5e-20 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1)
PFAM info
Representative CDS sequence
>Lus10010001 pacid=23176712 polypeptide=Lus10010001 locus=Lus10010001.g ID=Lus10010001.BGIv1.0 annot-version=v1.0
ATGGTTATCACAAGGAGCAATAGTACTCGTTGTACCGTCGACGATGGAGAAAGACTTCCATCGAACGCCGGAGAAGGTCGTCGTCGGAGAGTACTAGTAC
AGCCGGCGGCTGTAGCCAAGAAAAGGAGCTGCAGGAGGACGGCGAGGCGGAGGCGGCTTGTCGTGGAGAGAAGAGTTAGAGCGTTGAAGAAGCTGATCAT
ACCTAACGGTACCCGCGGTTATGAGGCGGCGACGGTGGGAGGGGTTTATAGGAAAACGGCTGATTATATAACGGGGTTGGAAATGAGGGTCAGGCTTATG
AAGATTCTGGTTCAGCTTTTGAGTGACTAG
AA sequence
>Lus10010001 pacid=23176712 polypeptide=Lus10010001 locus=Lus10010001.g ID=Lus10010001.BGIv1.0 annot-version=v1.0
MVITRSNSTRCTVDDGERLPSNAGEGRRRRVLVQPAAVAKKRSCRRTARRRRLVVERRVRALKKLIIPNGTRGYEAATVGGVYRKTADYITGLEMRVRLM
KILVQLLSD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G47270 bHLH bHLH151, UPB1 UPBEAT1, sequence-specific DNA... Lus10010001
[exp]
0 1
AT5G62280 Protein of unknown function (D... Lus10027191
[exp]
1.0 0.9884
AT4G22010 SKS4 SKU5 similar 4 (.1) Lus10020022
[exp]
3.0 0.9766
AT4G31470 CAP (Cysteine-rich secretory p... Lus10011318
[exp]
3.5 0.9759
AT5G40830 ATRAD3, ATATR S-adenosyl-L-methionine-depend... Lus10020803
[exp]
4.0 0.9825
AT2G26490 Transducin/WD40 repeat-like su... Lus10011655
[exp]
5.3 0.9618
AT1G06930 unknown protein Lus10024185
[exp]
7.7 0.9714
AT4G12520 Bifunctional inhibitor/lipid-t... Lus10032254
[exp]
8.0 0.9721
AT5G54370 Late embryogenesis abundant (L... Lus10033540
[exp]
8.1 0.9750
AT3G18200 nodulin MtN21 /EamA-like trans... Lus10038959
[exp]
8.4 0.9727
AT1G12740 CYP87A2 "cytochrome P450, family 87, s... Lus10024495
[exp]
9.6 0.9641

Lus10010001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.