Lus10010009 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G60540 79 / 3e-21 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2)
AT2G45070 79 / 4e-21 SEC61 BETA, SEC61BETA SUPPRESSORS OF SECRETION-DEFECTIVE 61 BETA, Preprotein translocase Sec, Sec61-beta subunit protein (.1.2.3.4)
AT5G60460 65 / 4e-15 Preprotein translocase Sec, Sec61-beta subunit protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011428 90 / 3e-25 AT3G60540 105 / 8e-32 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2)
Lus10037570 90 / 3e-25 AT3G60540 105 / 8e-32 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2)
Lus10025029 90 / 3e-25 AT3G60540 107 / 2e-32 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2)
Lus10036119 61 / 2e-13 AT5G60460 108 / 6e-32 Preprotein translocase Sec, Sec61-beta subunit protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G143100 87 / 4e-24 AT3G60540 86 / 1e-23 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2)
Potri.014G059000 85 / 2e-23 AT3G60540 81 / 7e-22 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2)
Potri.009G012000 61 / 2e-13 AT5G60460 86 / 6e-23 Preprotein translocase Sec, Sec61-beta subunit protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03911 Sec61_beta Sec61beta family
Representative CDS sequence
>Lus10010009 pacid=23176678 polypeptide=Lus10010009 locus=Lus10010009.g ID=Lus10010009.BGIv1.0 annot-version=v1.0
ATGGCTCTCGGTGGCGGAACAGCTCCCCCGAGAGGAAGTGCAGCAGCTGCTGCAAGCATGCGCAGGAGGAGGACAACCAGTGGCGGTGCAACAGGAGGAG
GAGCCGCCGGAACAATGCTCCAGTTCTATACGGATGATGCGCCGGGGCTGAAGATATCTCCTAACGTAGTCCTGTTTATGAGCATCGGTTTTATCGCTTT
CGTTGCCGTTCTCCACGTTGTCGGTAAGATATACATTGTCCGGAGGGAGACTTGA
AA sequence
>Lus10010009 pacid=23176678 polypeptide=Lus10010009 locus=Lus10010009.g ID=Lus10010009.BGIv1.0 annot-version=v1.0
MALGGGTAPPRGSAAAAASMRRRRTTSGGATGGGAAGTMLQFYTDDAPGLKISPNVVLFMSIGFIAFVAVLHVVGKIYIVRRET

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G60540 Preprotein translocase Sec, Se... Lus10010009 0 1
AT4G08230 glycine-rich protein (.1.2) Lus10041619 1.0 0.9432
AT5G39950 ATTRXH2, ATTRX2... Arabidopsis thioredoxin h2, th... Lus10030666 2.2 0.9132
AT2G46080 unknown protein Lus10036385 5.7 0.9098
AT1G56700 Peptidase C15, pyroglutamyl pe... Lus10001521 6.2 0.9299
AT1G25275 unknown protein Lus10006792 6.3 0.8927
AT1G22040 Galactose oxidase/kelch repeat... Lus10025357 7.3 0.9259
AT2G37480 unknown protein Lus10003982 8.4 0.9101
AT1G15270 Translation machinery associat... Lus10037543 8.9 0.9036
AT2G43080 AT-P4H-1 P4H isoform 1 (.1) Lus10031048 10.1 0.8791
AT4G36160 NAC ANAC076, VND2 VASCULAR-RELATED NAC-DOMAIN 2,... Lus10015312 10.8 0.8842

Lus10010009 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.