Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62550 131 / 5e-39 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G58450 82 / 3e-19 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G11930 82 / 3e-19 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT1G09740 74 / 1e-16 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT2G47710 69 / 7e-15 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G68300 65 / 3e-13 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G01520 60 / 3e-11 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT5G14680 59 / 4e-11 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G11360 56 / 2e-09 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT3G03270 55 / 2e-09 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025033 [exp] 258 / 2e-88 AT3G62550 186 / 1e-60 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029849 [exp] 111 / 2e-28 AT2G47430 489 / 2e-153 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10029850 [exp] 105 / 8e-28 AT3G62550 140 / 5e-42 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10006701 [exp] 73 / 4e-16 AT2G47710 218 / 1e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10009272 [exp] 72 / 6e-16 AT1G09740 227 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10007043 [exp] 71 / 2e-15 AT2G47710 214 / 2e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10034337 [exp] 71 / 2e-15 AT1G68300 164 / 2e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029310 [exp] 70 / 1e-14 AT3G11930 197 / 2e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10041436 [exp] 68 / 2e-14 AT1G68300 159 / 2e-50 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G122000 [exp] 148 / 1e-45 AT3G62550 195 / 1e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G196700 [exp] 147 / 7e-45 AT3G62550 196 / 6e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.013G009800 [exp] 111 / 5e-31 AT3G62550 172 / 2e-55 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.005G015200 [exp] 97 / 2e-25 AT3G62550 156 / 4e-49 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.006G198200 [exp] 86 / 6e-21 AT3G11930 209 / 9e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.016G064000 [exp] 81 / 4e-19 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.014G130100 [exp] 73 / 2e-16 AT2G47710 234 / 4e-80 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G104700 [exp] 71 / 2e-15 AT1G09740 251 / 2e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.008G221300 [exp] 70 / 1e-14 AT2G47710 199 / 2e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G205275 [exp] 67 / 4e-14 AT2G47710 226 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [flax] [poplar] HUP PF00582 [flax] [poplar] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Lus10010013 pacid=23176699 polypeptide=Lus10010013 locus=Lus10010013.g ID=Lus10010013.BGIv1.0 annot-version=v1.0 ATGGAAGCAAGAGGAGGAAACAAGGTGATGACGATAAGGAAGACGACGACGACGATGAAGAAGGAGAATAGAGGAGAGGAGGAGAGAGTAGTGGTGGTGG CGGTGGACGAGAGTGAAGAGAGCATGAATGCACTTTCATGGTGTCTTAACAACTTGGTCTCTAATCCAAATTCTCACCACTCTTCTGATAACGATCATGT CATTCTCCCCACCGTCGTCCTCCTCTACGTCAAGCCCCCTCCTCCCGTTTACCCTTCTTTCACCGCCGCTGCGTACATGTTCAACAATGACGTGATAGCA ACAATGGAGAGGCACAGTGCAGAGATGGTGAGCGGTGTGATGAGAAGAGCTGAAGCTGTTTACGGCAACTTCCTTAATCATGTGAGGCTAGAAAGGGCAG TAGGGAGTGGAGAAGCAAAGGAAGTGATTTGCAGCACTGTTAACCAGCTTGGAGCTGACACCTTGGTCATGGGTTGCCATGGTTACGGTTTCATCAAAAG GGCTCTACTGGGAAGTGTAAGCGATTATTGTGCTAAGCATGTCAAGTGTCCTGTGGTTATTGTCAAGCGTCAACAACAACAACAACACTGA
AA sequence Show only first row Show all	>Lus10010013 pacid=23176699 polypeptide=Lus10010013 locus=Lus10010013.g ID=Lus10010013.BGIv1.0 annot-version=v1.0 MEARGGNKVMTIRKTTTTMKKENRGEEERVVVVAVDESEESMNALSWCLNNLVSNPNSHHSSDNDHVILPTVVLLYVKPPPPVYPSFTAAAYMFNNDVIA TMERHSAEMVSGVMRRAEAVYGNFLNHVRLERAVGSGEAKEVICSTVNQLGADTLVMGCHGYGFIKRALLGSVSDYCAKHVKCPVVIVKRQQQQQH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G62550			Adenine nucleotide alpha hydro...		Lus10010013 [exp]	0	1
AT1G31770		ABCG14	ATP-binding cassette G14, ATP-...		Lus10035692 [exp]	7.4	0.7094
AT2G26530		AR781	Protein of unknown function (D...		Lus10032766 [exp]	7.6	0.7516
AT1G56300			Chaperone DnaJ-domain superfam...		Lus10020685 [exp]	10.0	0.6740
AT1G49230			RING/U-box superfamily protein...		Lus10006786 [exp]	10.6	0.7140
AT1G64970		VTE4, TMT1, G-T...	VITAMIN E DEFICIENT 4, gamma-t...		Lus10020357 [exp]	11.4	0.6962
AT4G38650			Glycosyl hydrolase family 10 p...		Lus10025054 [exp]	14.7	0.6775
AT2G36540			Haloacid dehalogenase-like hyd...		Lus10019759 [exp]	17.5	0.6490
AT3G23230	AP2_ERF	ERF98	Integrase-type DNA-binding sup...		Lus10011831 [exp]	17.9	0.6804
AT2G42940	AT-hook		Predicted AT-hook DNA-binding ...		Lus10020763 [exp]	18.5	0.6772
AT1G36320			unknown protein		Lus10036666 [exp]	20.1	0.6630

Compare expression of checked genes

Lus10010013 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.