Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G49300 62 / 8e-13 GATA GATA16 GATA transcription factor 16 (.1) AT5G26930 59 / 4e-12 GATA GATA23 GATA transcription factor 23 (.1) AT4G16141 59 / 2e-11 GATA GATA type zinc finger transcription factor family protein (.1) AT3G16870 59 / 3e-11 GATA GATA17 GATA transcription factor 17 (.1) AT4G26150 59 / 5e-11 GATA GATA22, CGA1, GNL GNC-LIKE, GATA TRANSCRIPTION FACTOR 22, cytokinin-responsive gata factor 1 (.1) AT5G56860 59 / 7e-11 GATA GATA21, GNC GATA, nitrate-inducible, carbon metabolism-involved, GATA TRANSCRIPTION FACTOR 21, GATA type zinc finger transcription factor family protein (.1) AT3G06740 56 / 1e-10 GATA GATA15 GATA transcription factor 15 (.1) AT1G08010 57 / 2e-10 GATA GATA11 GATA transcription factor 11 (.1.2) AT2G18380 55 / 6e-10 GATA GATA20, HANL1 hanaba taranu like 1, GATA transcription factor 20 (.1) AT1G08000 56 / 7e-10 GATA GATA10 GATA transcription factor 10 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036329 [exp] 170 / 6e-52 AT1G02700 189 / 1e-57 unknown protein Lus10031464 [exp] 60 / 6e-12 AT3G24050 69 / 3e-15 GATA transcription factor 1 (.1) Lus10037721 [exp] 59 / 1e-11 AT3G06740 153 / 2e-48 GATA transcription factor 15 (.1) Lus10016849 [exp] 59 / 1e-11 AT3G06740 154 / 6e-49 GATA transcription factor 15 (.1) Lus10029863 [exp] 59 / 3e-11 AT4G16141 90 / 1e-22 GATA type zinc finger transcription factor family protein (.1) Lus10020684 [exp] 58 / 8e-11 AT4G16141 94 / 9e-24 GATA type zinc finger transcription factor family protein (.1) Lus10028301 [exp] 55 / 9e-10 AT3G50870 135 / 4e-39 MONOPOLE, HANABA TANARU, GATA TRANSCRIPTION FACTOR 18, GATA type zinc finger transcription factor family protein (.1) Lus10037572 [exp] 55 / 1e-09 AT4G32890 236 / 2e-76 GATA transcription factor 9 (.1) Lus10011430 [exp] 55 / 1e-09 AT4G32890 237 / 9e-77 GATA transcription factor 9 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G124400 [exp] 67 / 5e-15 AT5G49300 106 / 2e-30 GATA transcription factor 16 (.1) Potri.002G199800 [exp] 66 / 3e-14 AT5G49300 112 / 1e-32 GATA transcription factor 16 (.1) Potri.005G020500 [exp] 64 / 1e-13 AT3G06740 67 / 1e-14 GATA transcription factor 15 (.1) Potri.008G213900 [exp] 58 / 2e-11 AT3G06740 126 / 4e-38 GATA transcription factor 15 (.1) Potri.010G001300 [exp] 58 / 3e-11 AT3G06740 135 / 2e-41 GATA transcription factor 15 (.1) Potri.006G229200 [exp] 59 / 7e-11 AT4G26150 111 / 3e-28 GNC-LIKE, GATA TRANSCRIPTION FACTOR 22, cytokinin-responsive gata factor 1 (.1) Potri.010G223300 [exp] 59 / 7e-11 AT3G54810 148 / 8e-42 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2) Potri.008G038900 [exp] 57 / 2e-10 AT3G54810 150 / 1e-42 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2) Potri.018G053600 [exp] 56 / 7e-10 AT4G26150 75 / 4e-15 GNC-LIKE, GATA TRANSCRIPTION FACTOR 22, cytokinin-responsive gata factor 1 (.1) Potri.005G122700 [exp] 55 / 1e-09 AT3G50870 198 / 1e-62 MONOPOLE, HANABA TANARU, GATA TRANSCRIPTION FACTOR 18, GATA type zinc finger transcription factor family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF00320 [flax] [poplar] GATA GATA zinc finger
Representative CDS sequence Show only first row Show all	>Lus10010027 pacid=23176658 polypeptide=Lus10010027 locus=Lus10010027.g ID=Lus10010027.BGIv1.0 annot-version=v1.0 ATGGAAACAGAAAGCACCTCTTCACAATTTATCTGCAGACAACAAGAAGATCAGATGATGATTCGAATTCGCAGCTGCATCGACTGCCACACCACCACCA CTCCTTGCTGGCGCGGCGGCCCTGCCGGTCCAAGGACGTTGTGCAATGCGTGTGGGATTCGGTACAGGAAAAGTAGAAACGCTGCTGCTTCCACTTCTTC TTCTCCTTCGTCTTCATCGTCATCTGGTTCAGCGAAGAAGAAGAGGAAGACCATGATTGGGAAAGGGAAAGAAGCAGGAGCAGTTCCGGTGAAGAAGCTA CTGGGTTTGATGGGTTTGGACAGCTGGAAAAGGAAGAAGCAACAGTTGGGGGAGGTAGAGATTGCTGCTGTTCTGTTGATGTCTCTTTCTGGTTCTATCT CTTCTTCTTCTTCTAAGTGCTAA
AA sequence Show only first row Show all	>Lus10010027 pacid=23176658 polypeptide=Lus10010027 locus=Lus10010027.g ID=Lus10010027.BGIv1.0 annot-version=v1.0 METESTSSQFICRQQEDQMMIRIRSCIDCHTTTTPCWRGGPAGPRTLCNACGIRYRKSRNAAASTSSSPSSSSSSGSAKKKRKTMIGKGKEAGAVPVKKL LGLMGLDSWKRKKQQLGEVEIAAVLLMSLSGSISSSSSKC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G49300	GATA	GATA16	GATA transcription factor 16 (...		Lus10010027 [exp]	0	1
AT3G14900		EMB3120	EMBRYO DEFECTIVE 3120, unknown...		Lus10000244 [exp]	2.4	0.8192
AT3G14900		EMB3120	EMBRYO DEFECTIVE 3120, unknown...		Lus10039570 [exp]	2.4	0.7963
AT1G02370			Tetratricopeptide repeat (TPR)...		Lus10021053 [exp]	3.2	0.8425
AT1G02700			unknown protein		Lus10036329 [exp]	14.5	0.7699
AT4G34740		CIA1, ATASE2, A...	CHLOROPLAST IMPORT APPARATUS 1...		Lus10018063 [exp]	18.4	0.7487
AT3G13160			Tetratricopeptide repeat (TPR)...		Lus10018393 [exp]	20.6	0.7749
AT2G35390			Phosphoribosyltransferase fami...		Lus10030948 [exp]	21.6	0.7442
AT1G70600			Ribosomal protein L18e/L15 sup...		Lus10006207 [exp]	21.6	0.7962
AT1G70600			Ribosomal protein L18e/L15 sup...		Lus10024161 [exp]	25.1	0.7587
AT5G12100			pentatricopeptide (PPR) repeat...		Lus10023863 [exp]	28.1	0.7511

Compare expression of checked genes

Lus10010027 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.