Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G23770 103 / 2e-27 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) AT2G33580 91 / 5e-23 Protein kinase superfamily protein (.1) AT3G23750 88 / 5e-22 Leucine-rich repeat protein kinase family protein (.1) AT1G66150 87 / 1e-21 TMK1 transmembrane kinase 1 (.1) AT3G21630 86 / 2e-21 LYSMRLK1, CERK1 LYSM DOMAIN RECEPTOR-LIKE KINASE 1, chitin elicitor receptor kinase 1 (.1) AT5G62710 86 / 3e-21 Leucine-rich repeat protein kinase family protein (.1) AT1G11050 86 / 5e-21 Protein kinase superfamily protein (.1) AT5G02290 85 / 6e-21 NAK Protein kinase superfamily protein (.1.2) AT2G25220 85 / 8e-21 Protein kinase superfamily protein (.1.2) AT1G51940 85 / 8e-21 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000139 [exp] 180 / 6e-61 AT2G33580 103 / 3e-27 Protein kinase superfamily protein (.1) Lus10016299 [exp] 172 / 4e-52 AT2G23770 368 / 3e-119 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10032735 [exp] 145 / 3e-42 AT2G23770 305 / 1e-94 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10018788 [exp] 145 / 3e-42 AT2G23770 312 / 3e-97 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10016794 [exp] 114 / 4e-32 AT2G23770 219 / 2e-66 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10022488 [exp] 114 / 5e-31 AT2G23770 391 / 2e-128 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10039406 [exp] 106 / 1e-28 AT2G33580 229 / 4e-68 Protein kinase superfamily protein (.1) Lus10041171 [exp] 103 / 3e-27 AT2G33580 224 / 1e-64 Protein kinase superfamily protein (.1) Lus10021889 [exp] 102 / 6e-27 AT2G23770 256 / 2e-77 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G040000 [exp] 134 / 2e-38 AT2G23770 345 / 1e-110 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.005G128300 [exp] 105 / 3e-28 AT2G23770 394 / 2e-129 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.005G259600 [exp] 105 / 3e-28 AT2G33580 637 / 0.0 Protein kinase superfamily protein (.1) Potri.005G128200 [exp] 103 / 3e-27 AT2G23770 514 / 4e-176 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.008G160600 [exp] 103 / 3e-27 AT2G33580 217 / 8e-62 Protein kinase superfamily protein (.1) Potri.010G078700 [exp] 102 / 5e-27 AT2G23770 288 / 5e-89 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.007G032100 [exp] 101 / 1e-26 AT2G23770 513 / 6e-175 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.014G156400 [exp] 98 / 2e-25 AT3G21630 678 / 0.0 LYSM DOMAIN RECEPTOR-LIKE KINASE 1, chitin elicitor receptor kinase 1 (.1) Potri.002G226600 [exp] 96 / 8e-25 AT3G21630 697 / 0.0 LYSM DOMAIN RECEPTOR-LIKE KINASE 1, chitin elicitor receptor kinase 1 (.1) Potri.011G010000 [exp] 95 / 2e-24 AT3G21630 673 / 0.0 LYSM DOMAIN RECEPTOR-LIKE KINASE 1, chitin elicitor receptor kinase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF00069 [flax] [poplar] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Lus10010032 pacid=23155637 polypeptide=Lus10010032 locus=Lus10010032.g ID=Lus10010032.BGIv1.0 annot-version=v1.0 ATGGCTCTAGATGATGCTAATGGCCTTCACTATCTTCACAACTTCACTGAGCCTGCTTATATTAAGGACATCAAGAGCAGCAATGTGTTGCTGAACAGCA ACCTTAGAGCCAAGATCATCAATTTCAGCCTGGCCAGAGCAGCGGTGAGGGACTCGGCGCTCACGCCCCATTTGATTGGGACGAGAGGATACTTGGCGCC GGAGTATCTCCAAACTGGAGAGGTAACACCTAAGGTGGATGTGTATGCATTTGGTGTGGTGTTGTAG
AA sequence Show only first row Show all	>Lus10010032 pacid=23155637 polypeptide=Lus10010032 locus=Lus10010032.g ID=Lus10010032.BGIv1.0 annot-version=v1.0 MALDDANGLHYLHNFTEPAYIKDIKSSNVLLNSNLRAKIINFSLARAAVRDSALTPHLIGTRGYLAPEYLQTGEVTPKVDVYAFGVVL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G33580			Protein kinase superfamily pro...		Lus10010032 [exp]	0	1
AT2G33580			Protein kinase superfamily pro...		Lus10000139 [exp]	1.0	0.9491
AT3G13540	MYB	ATMYB5, ATM2	myb domain protein 5 (.1)		Lus10039173 [exp]	18.6	0.6477
AT3G03320			RNA-binding ASCH domain protei...		Lus10012450 [exp]	24.7	0.6568
AT5G28540		BIP1	heat shock protein 70 (Hsp 70)...		Lus10038374 [exp]	46.4	0.6335
					Lus10029487 [exp]	108.3	0.5890
AT1G78950		ATLUP3	Terpenoid cyclases family prot...		Lus10016438 [exp]	190.8	0.5714
AT3G27080		TOM20-3	translocase of outer membrane ...		Lus10011363 [exp]	206.9	0.5612
AT3G13810	C2H2ZnF	ATIDD11	indeterminate(ID)-domain 11 (....		Lus10004840 [exp]	217.5	0.5510
AT1G56090			Tetratricopeptide repeat (TPR)...		Lus10008024 [exp]	258.8	0.5349

Compare expression of checked genes

Lus10010032 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.