Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G65910 102 / 4e-24 NAC ANAC028 NAC domain containing protein 28 (.1) AT3G44290 94 / 7e-22 NAC ANAC060 NAC domain containing protein 60 (.1) AT4G27410 92 / 1e-21 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) AT5G17260 93 / 4e-21 NAC ANAC086 NAC domain containing protein 86 (.1) AT1G56010 92 / 4e-21 NAC NAC1, ANAC021, ANAC022 Arabidopsis NAC domain containing protein 22, Arabidopsis NAC domain containing protein 21, NAC domain containing protein 1 (.1.2) AT3G17730 89 / 6e-21 NAC ANAC057 NAC domain containing protein 57 (.1) AT5G04410 92 / 8e-21 NAC NAC2, ANAC078 Arabidopsis NAC domain containing protein 78, NAC domain containing protein 2 (.1) AT3G10500 92 / 9e-21 NAC ANAC053 NAC domain containing protein 53 (.1) AT5G22290 90 / 2e-20 NAC FSQ6, FAN, ANAC089 fructose-sensing quantitative trait locus 6, NAC domain containing protein 89 (.1) AT3G10490 88 / 2e-20 NAC ANAC051, ANAC052 Arabidopsis NAC domain containing protein 51, NAC domain containing protein 52 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010371 [exp] 283 / 2e-97 AT5G17260 70 / 1e-14 NAC domain containing protein 86 (.1) Lus10013964 [exp] 93 / 1e-21 AT1G61110 225 / 2e-71 NAC domain containing protein 25 (.1) Lus10015389 [exp] 93 / 2e-21 AT1G61110 223 / 6e-71 NAC domain containing protein 25 (.1) Lus10042284 [exp] 88 / 6e-20 AT3G17730 348 / 1e-121 NAC domain containing protein 57 (.1) Lus10026373 [exp] 87 / 9e-20 AT3G17730 348 / 2e-121 NAC domain containing protein 57 (.1) Lus10020794 [exp] 89 / 1e-19 AT5G10360 449 / 8e-153 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2) Lus10007377 [exp] 89 / 1e-19 AT1G65910 431 / 7e-143 NAC domain containing protein 28 (.1) Lus10037156 [exp] 87 / 1e-19 AT1G69490 318 / 2e-109 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Lus10001809 [exp] 86 / 1e-19 AT5G13180 271 / 6e-92 VND-interacting 2, NAC domain containing protein 83 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G025700 [exp] 283 / 2e-95 AT1G69490 88 / 3e-20 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Potri.008G031800 [exp] 92 / 6e-21 AT5G04410 511 / 6e-177 Arabidopsis NAC domain containing protein 78, NAC domain containing protein 2 (.1) Potri.005G098200 [exp] 90 / 9e-21 AT1G56010 332 / 6e-114 Arabidopsis NAC domain containing protein 22, Arabidopsis NAC domain containing protein 21, NAC domain containing protein 1 (.1.2) Potri.010G229900 [exp] 92 / 1e-20 AT5G04410 481 / 4e-165 Arabidopsis NAC domain containing protein 78, NAC domain containing protein 2 (.1) Potri.015G030200 [exp] 89 / 1e-20 AT3G17730 374 / 6e-133 NAC domain containing protein 57 (.1) Potri.010G174600 [exp] 90 / 2e-20 AT1G54330 290 / 2e-97 NAC domain containing protein 20 (.1) Potri.009G161300 [exp] 90 / 3e-20 AT2G27300 273 / 4e-88 Arabidopsis NAC domain containing protein 40, NTM1-like 8 (.1) Potri.007G065400 [exp] 89 / 3e-20 AT1G56010 337 / 4e-116 Arabidopsis NAC domain containing protein 22, Arabidopsis NAC domain containing protein 21, NAC domain containing protein 1 (.1.2) Potri.008G081500 [exp] 89 / 3e-20 AT1G54330 316 / 1e-107 NAC domain containing protein 20 (.1) Potri.001G144400 [exp] 89 / 6e-20 AT4G17980 318 / 2e-108 NAC domain containing protein 71 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10010037 pacid=23155631 polypeptide=Lus10010037 locus=Lus10010037.g ID=Lus10010037.BGIv1.0 annot-version=v1.0 ATGCCGTTTGATCTTCCGCCGGGTTGTCGGTTCTACCCTTCCGACCAGCAGCTTCTATGTTACTATCTTACCAATAAGAACCACGGGGATGGCGACGGCT GCAATCAACATGAAGATACCAATGGATACGATTTGATAAAGGAGCTCGACTTGTATGATCACGAGCCGTTTGATTTGCCCCAACACTCGTGCTATTCGTA TGGTCCCAAGGGGAGGAAAAAACACTGGTTCTGCTATGCGAAAATTAGGGTTTCCAAGGAAGAAAACAGGGGAAATAGGAGGCGAGCCAAGGGAGGGTAT TGGAGAAGGTTAGGTAAGGTTAGAGACGTGATGGAAAGTGGCTGGAATAGTGCGATCGTCGGTACCAGAACTAGGTTTGTCTTTTATTTGGGGAATTCCG TGAAGAGTGCAACCAGAACTGACTGGATTTTGTACGAGTACTCTCTGCTTGATCACTCGATGGCTTCTTTTGTCTTGTGCAGAGTCTTCGTTAAGTCCCG CATTGGAAATAGTGTATCTGAGAATATTTTAAGTTGCTGCGCTGAAGAAAGTGTTTCTGCTTTACGCCACATTGGCGTCCAGTGTGATGGAATTAGTGAT CATGTGCAACATGAAACTTCTTCTGGCGATAAGAACGAGGTGCCAGAGCATTTGTTGATGCAAAACAATACCCCAGCGGGGGATACCTCTGGAACAAATG GGTTTGCCTCTGTTTCTGGATATCAGTACCTATTACCAGCAAATGCACCACCGGATCAGAATCATGAGCATGTAGAAAGAAAGTGGTTTACCGACGCTGA CCCTAGTGAGCTGTTACAAATCATCATGGAAGAAGATTACCTAGAGATGGATGATCTTAAATAA
AA sequence Show only first row Show all	>Lus10010037 pacid=23155631 polypeptide=Lus10010037 locus=Lus10010037.g ID=Lus10010037.BGIv1.0 annot-version=v1.0 MPFDLPPGCRFYPSDQQLLCYYLTNKNHGDGDGCNQHEDTNGYDLIKELDLYDHEPFDLPQHSCYSYGPKGRKKHWFCYAKIRVSKEENRGNRRRAKGGY WRRLGKVRDVMESGWNSAIVGTRTRFVFYLGNSVKSATRTDWILYEYSLLDHSMASFVLCRVFVKSRIGNSVSENILSCCAEESVSALRHIGVQCDGISD HVQHETSSGDKNEVPEHLLMQNNTPAGDTSGTNGFASVSGYQYLLPANAPPDQNHEHVERKWFTDADPSELLQIIMEEDYLEMDDLK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G65910	NAC	ANAC028	NAC domain containing protein ...		Lus10010037 [exp]	0	1
AT3G52760			Integral membrane Yip1 family ...		Lus10022723 [exp]	1.4	0.8008
AT1G68070			Zinc finger, C3HC4 type (RING ...		Lus10034587 [exp]	1.4	0.8010
AT3G57120			Protein kinase superfamily pro...		Lus10038716 [exp]	5.0	0.7762
AT3G26600		ARO4	armadillo repeat only 4 (.1)		Lus10026695 [exp]	8.1	0.7753
AT4G08455			BTB/POZ domain-containing prot...		Lus10042763 [exp]	9.0	0.7692
AT1G67850			Protein of unknown function (D...		Lus10011414 [exp]	9.2	0.7783
AT3G09032			unknown protein		Lus10027777 [exp]	11.9	0.7785
AT5G66320	GATA	GATA5	GATA transcription factor 5 (....		Lus10031096 [exp]	15.9	0.7373
AT5G01850			Protein kinase superfamily pro...		Lus10025154 [exp]	16.1	0.7542
AT3G55520			FKBP-like peptidyl-prolyl cis-...		Lus10004714 [exp]	18.6	0.7544

Compare expression of checked genes

Lus10010037 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.