Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G27060 105 / 1e-27 Regulator of chromosome condensation (RCC1) family protein (.1) AT5G60870 53 / 6e-09 RUG3 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3) AT1G76950 52 / 1e-08 PRAF1 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT3G23270 52 / 2e-08 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT5G12350 51 / 3e-08 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT5G19420 51 / 4e-08 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) AT5G42140 49 / 2e-07 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT5G63860 48 / 3e-07 UVR8 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) AT3G47660 48 / 4e-07 Regulator of chromosome condensation (RCC1) family protein (.1) AT4G14368 47 / 6e-07 Regulator of chromosome condensation (RCC1) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008730 [exp] 154 / 4e-48 AT1G27060 132 / 1e-36 Regulator of chromosome condensation (RCC1) family protein (.1) Lus10037219 [exp] 144 / 2e-42 AT1G27060 424 / 1e-147 Regulator of chromosome condensation (RCC1) family protein (.1) Lus10012474 [exp] 131 / 1e-39 AT1G27060 89 / 2e-21 Regulator of chromosome condensation (RCC1) family protein (.1) Lus10036707 [exp] 130 / 7e-37 AT1G27060 375 / 1e-128 Regulator of chromosome condensation (RCC1) family protein (.1) Lus10042215 [exp] 56 / 8e-10 AT5G60870 547 / 0.0 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3) Lus10024157 [exp] 56 / 1e-09 AT5G19420 1279 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Lus10039525 [exp] 55 / 2e-09 AT5G19420 1245 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Lus10008599 [exp] 52 / 5e-09 AT5G60870 231 / 2e-77 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3) Lus10036737 [exp] 53 / 7e-09 AT1G69710 974 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G107000 [exp] 114 / 3e-31 AT1G27060 446 / 1e-156 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.001G026900 [exp] 54 / 2e-09 AT5G19420 1281 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.005G190000 [exp] 54 / 3e-09 AT5G42140 1407 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Potri.004G000600 [exp] 53 / 5e-09 AT5G60870 534 / 0.0 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3) Potri.002G070300 [exp] 52 / 2e-08 AT5G42140 1422 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Potri.003G197600 [exp] 52 / 2e-08 AT5G19420 1292 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.T124906 [exp] 52 / 2e-08 AT5G19420 1292 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.009G071800 [exp] 52 / 2e-08 AT5G19420 1610 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.008G167500 [exp] 51 / 3e-08 AT4G14368 1266 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.004G080900 [exp] 51 / 3e-08 AT1G65920 940 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [flax] [poplar] Beta_propeller PF00415 [flax] [poplar] RCC1 Regulator of chromosome condensation (RCC1) repeat
Representative CDS sequence Show only first row Show all	>Lus10010038 pacid=23155643 polypeptide=Lus10010038 locus=Lus10010038.g ID=Lus10010038.BGIv1.0 annot-version=v1.0 ATGGATGAAGAAGACGAGAGAGGCGAAGAACATGAACAAATCTGGACCTGGGGAGCTAGAACAGACGGACAACTCGGAACTGGGAAGCTGGAGGATGAGC TCCTCCCTAAGCTCCTCCGTCCTCTGCTGCTCACCGCCGCCGAACTAATCTCCATGCTCGCCTGCGGCGGAGCTCACGTTATTGCTTTGACGACAGGTGG AAGAGTACTAACATGGGGAAGAGGCACATCTAGCCAACTTGGCCATGGAGATACGTTGACCTGCTTAGAGCCAAAGATTGTGGAGTCTTTGAAGAATGAT GTAATAGTAACTCATGTCTCTGCTGGATGGAGCCTCTCTGGATTTGTTCTTGGAAATGGAAAGACTATTGATTTTACGCCCCTAGTCATGTGTTATGGCC TCCACTAG
AA sequence Show only first row Show all	>Lus10010038 pacid=23155643 polypeptide=Lus10010038 locus=Lus10010038.g ID=Lus10010038.BGIv1.0 annot-version=v1.0 MDEEDERGEEHEQIWTWGARTDGQLGTGKLEDELLPKLLRPLLLTAAELISMLACGGAHVIALTTGGRVLTWGRGTSSQLGHGDTLTCLEPKIVESLKND VIVTHVSAGWSLSGFVLGNGKTIDFTPLVMCYGLH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G27060			Regulator of chromosome conden...		Lus10010038 [exp]	0	1
AT1G09620			ATP binding;leucine-tRNA ligas...		Lus10025653 [exp]	13.2	0.7249
AT4G31540		ATEXO70G1	exocyst subunit exo70 family p...		Lus10042439 [exp]	40.2	0.6712
AT1G01970			Tetratricopeptide repeat (TPR)...		Lus10015864 [exp]	61.5	0.6541
AT4G10620			P-loop containing nucleoside t...		Lus10035986 [exp]	84.1	0.6414
AT3G20050		ATTCP-1	T-complex protein 1 alpha subu...		Lus10036713 [exp]	233.6	0.5802

Compare expression of checked genes

Lus10010038 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.