Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G51770 75 / 3e-17 ATEOL1, ETO1 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) AT4G02680 57 / 1e-10 EOL1 ETO1-like 1 (.1) AT5G58550 56 / 1e-10 EOL2 ETO1-like 2 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002206 [exp] 143 / 4e-41 AT3G51770 1089 / 0.0 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) Lus10012238 [exp] 139 / 1e-39 AT3G51770 1092 / 0.0 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) Lus10022660 [exp] 89 / 4e-22 AT3G51770 1231 / 0.0 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) Lus10012472 [exp] 67 / 5e-15 AT3G51770 230 / 2e-70 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) Lus10031859 [exp] 65 / 1e-13 AT3G51770 1088 / 0.0 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) Lus10031289 [exp] 63 / 1e-12 AT3G51770 1083 / 0.0 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) Lus10022084 [exp] 61 / 5e-12 AT4G02680 1267 / 0.0 ETO1-like 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G123800 [exp] 79 / 1e-18 AT3G51770 1415 / 0.0 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) Potri.006G103400 [exp] 74 / 5e-17 AT3G51770 1399 / 0.0 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) Potri.009G075300 [exp] 64 / 2e-13 AT3G51770 1206 / 0.0 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) Potri.001G280100 [exp] 63 / 7e-13 AT3G51770 1192 / 0.0 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) Potri.002G048300 [exp] 52 / 7e-09 AT4G02680 1293 / 0.0 ETO1-like 1 (.1) Potri.005G214400 [exp] 49 / 6e-08 AT4G02680 1264 / 0.0 ETO1-like 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010041 pacid=23155628 polypeptide=Lus10010041 locus=Lus10010041.g ID=Lus10010041.BGIv1.0 annot-version=v1.0 ATGAATTCGATATCCGCGGAAGGAATGAAGGCAGTAGAAAGTTTCAGCAGGACGAAGAAGTTAGCCATTGTTGATAATCTACCTTTACTTCTGGAGATTC TATCATTCGCGAACCGATTCTGCTGCGGCACATTGAAAGCCACTTGCGATTCTCGATTGGCTTTCTTTTTCTTGGCTTCCTTAATCTTGGACATGGACCT AACATTGTCCATTATCGACTACGGATTGGAAGAGACGACTCATCTTACATGGACCTTAGCTTCCGAGCTCGATGAACCATCACTACATTAG
AA sequence Show only first row Show all	>Lus10010041 pacid=23155628 polypeptide=Lus10010041 locus=Lus10010041.g ID=Lus10010041.BGIv1.0 annot-version=v1.0 MNSISAEGMKAVESFSRTKKLAIVDNLPLLLEILSFANRFCCGTLKATCDSRLAFFFLASLILDMDLTLSIIDYGLEETTHLTWTLASELDEPSLH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G51770		ATEOL1, ETO1	ARABIDOPSIS ETHYLENE OVERPRODU...		Lus10010041 [exp]	0	1
AT3G08960			ARM repeat superfamily protein...		Lus10008367 [exp]	1.4	0.8002
AT5G56700			FBD / Leucine Rich Repeat doma...		Lus10017238 [exp]	7.3	0.7842
AT3G51770		ATEOL1, ETO1	ARABIDOPSIS ETHYLENE OVERPRODU...		Lus10012472 [exp]	8.0	0.7873
AT5G53150			DNAJ heat shock N-terminal dom...		Lus10028842 [exp]	9.9	0.7954
AT1G09620			ATP binding;leucine-tRNA ligas...		Lus10025653 [exp]	20.2	0.7795
AT5G47940			unknown protein		Lus10016406 [exp]	26.9	0.7836
AT3G49990			unknown protein		Lus10015447 [exp]	36.9	0.7675
AT1G56070		LOS1, AT1G56075...	LOW EXPRESSION OF OSMOTICALLY ...		Lus10031201 [exp]	50.8	0.7730
AT5G53890		AtPSKR2	phytosylfokine-alpha receptor ...		Lus10005403 [exp]	54.5	0.6904
AT2G45880	BZR	BAM7, BMY4	BETA-AMYLASE 4, beta-amylase 7...		Lus10017819 [exp]	83.6	0.7182

Compare expression of checked genes

Lus10010041 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.