Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G46990 115 / 6e-33 AUX_IAA IAA20 indole-3-acetic acid inducible 20 (.1) AT3G62100 114 / 2e-32 AUX_IAA IAA30 indole-3-acetic acid inducible 30 (.1) AT3G17600 109 / 8e-31 AUX_IAA IAA31 indole-3-acetic acid inducible 31 (.1) AT4G28640 97 / 5e-25 AUX_IAA IAA11 indole-3-acetic acid inducible 11 (.1.2.3) AT2G33310 93 / 2e-23 AUX_IAA IAA13 auxin-induced protein 13 (.1.2.3) AT3G23030 88 / 2e-22 AUX_IAA IAA2 indole-3-acetic acid inducible 2 (.1) AT1G04550 89 / 6e-22 AUX_IAA BDL, IAA12 indole-3-acetic acid inducible 12, BODENLOS, AUX/IAA transcriptional regulator family protein (.1.2) AT5G43700 86 / 3e-21 AUX_IAA IAA4, ATAUX2-11 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) AT5G25890 85 / 3e-21 AUX_IAA IAR2, IAA28 IAA-ALANINE RESISTANT 2, indole-3-acetic acid inducible 28 (.1) AT3G16500 86 / 1e-20 AUX_IAA IAA26, PAP1 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007193 [exp] 269 / 6e-94 AT3G62100 117 / 4e-34 indole-3-acetic acid inducible 30 (.1) Lus10038025 [exp] 176 / 1e-56 AT3G62100 127 / 1e-37 indole-3-acetic acid inducible 30 (.1) Lus10009967 [exp] 169 / 2e-54 AT3G62100 128 / 2e-38 indole-3-acetic acid inducible 30 (.1) Lus10014464 [exp] 100 / 9e-26 AT2G33310 231 / 4e-75 auxin-induced protein 13 (.1.2.3) Lus10023719 [exp] 99 / 4e-25 AT2G33310 223 / 4e-72 auxin-induced protein 13 (.1.2.3) Lus10022868 [exp] 90 / 4e-22 AT4G28640 198 / 1e-62 indole-3-acetic acid inducible 11 (.1.2.3) Lus10038285 [exp] 84 / 7e-20 AT3G16500 224 / 3e-72 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1) Lus10037587 [exp] 84 / 7e-20 AT3G16500 251 / 4e-83 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1) Lus10028222 [exp] 84 / 1e-19 AT5G65670 322 / 3e-110 indole-3-acetic acid inducible 9 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G111700 [exp] 138 / 4e-42 AT3G62100 150 / 7e-47 indole-3-acetic acid inducible 30 (.1) Potri.002G186400 [exp] 132 / 9e-40 AT3G62100 147 / 3e-45 indole-3-acetic acid inducible 30 (.1) Potri.008G172400 [exp] 98 / 5e-25 AT2G33310 246 / 4e-81 auxin-induced protein 13 (.1.2.3) Potri.010G065200 [exp] 97 / 8e-25 AT2G33310 243 / 4e-80 auxin-induced protein 13 (.1.2.3) Potri.002G256600 [exp] 91 / 1e-22 AT4G28640 191 / 6e-60 indole-3-acetic acid inducible 11 (.1.2.3) Potri.013G041300 [exp] 85 / 9e-21 AT5G43700 239 / 5e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.005G218200 [exp] 84 / 1e-20 AT5G43700 243 / 2e-82 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.005G053800 [exp] 84 / 2e-20 AT5G43700 239 / 7e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.002G045000 [exp] 83 / 3e-20 AT5G43700 236 / 5e-80 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.001G190300 [exp] 85 / 5e-20 AT3G16500 235 / 3e-76 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF02309 [flax] [poplar] AUX_IAA AUX/IAA family
Representative CDS sequence Show only first row Show all	>Lus10010081 pacid=23158868 polypeptide=Lus10010081 locus=Lus10010081.g ID=Lus10010081.BGIv1.0 annot-version=v1.0 ATGGGCAGAGGAGGAGCAAGCAATCATCCTCACCTCCATTCCTCTTGTTCTTCTTCTTCCTCGTCATCCACTTCTCAACTGATGATGAGGAAAGACCTCA GCACAGACCTCAGGCTCGGCAGATCAGCTGCAGCTGCAGAGGATCATGAAGGATTCATGTATAGGAACAGCAAGCGTAATAACGGTACCACTTGCTTTGT GAAGGTTTACATGGAAGGCATCCCAATTGGGAGGAAGTTGGATTTGCTGGCTTACAGCTGTTACGAGGACATGATCCGTACCGTTGATAACATGTTCGCC ACCAACATTCTCTGGGATGAGATGATGGAGGGTGAGAATAATAATTATTACAGGGAGCAGAATCAAGTTATTTATCATGTTTTGACGTATGAAGACAAAG AAGGGGACTGGCTCATTGTTGGAGATGTTCCCTGGGAGATGTTTGTGTCGTGTGTGAAGAGATTGAAGATCACTAGAGCAGACAGCTTGTGA
AA sequence Show only first row Show all	>Lus10010081 pacid=23158868 polypeptide=Lus10010081 locus=Lus10010081.g ID=Lus10010081.BGIv1.0 annot-version=v1.0 MGRGGASNHPHLHSSCSSSSSSSTSQLMMRKDLSTDLRLGRSAAAAEDHEGFMYRNSKRNNGTTCFVKVYMEGIPIGRKLDLLAYSCYEDMIRTVDNMFA TNILWDEMMEGENNNYYREQNQVIYHVLTYEDKEGDWLIVGDVPWEMFVSCVKRLKITRADSL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G46990	AUX_IAA	IAA20	indole-3-acetic acid inducible...		Lus10010081 [exp]	0	1
AT4G33790		G7, FAR3, CER4	FATTY ACID REDUCTASE 3, ECERIF...		Lus10006264 [exp]	1.7	0.8100
AT2G07050		CAS1	cycloartenol synthase 1 (.1)		Lus10008544 [exp]	5.1	0.7822
AT3G57570			ARM repeat superfamily protein...		Lus10026304 [exp]	8.5	0.6691
AT4G33790		G7, FAR3, CER4	FATTY ACID REDUCTASE 3, ECERIF...		Lus10020584 [exp]	11.7	0.7608
AT2G37690			phosphoribosylaminoimidazole c...		Lus10005526 [exp]	12.0	0.7478
AT4G23440			Disease resistance protein (TI...		Lus10024640 [exp]	17.8	0.7408
AT5G47380			Protein of unknown function, D...		Lus10007795 [exp]	20.4	0.7463
AT5G17430	AP2_ERF	BBM	BABY BOOM, Integrase-type DNA-...		Lus10001185 [exp]	21.7	0.7403
AT1G29630			5'-3' exonuclease family prote...		Lus10002782 [exp]	26.8	0.7374
AT4G23440			Disease resistance protein (TI...		Lus10032275 [exp]	29.7	0.7392

Compare expression of checked genes

Lus10010081 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.