Lus10010089 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G02310 146 / 2e-42 MAN1 endo-beta-mannanase 1, Glycosyl hydrolase superfamily protein (.1)
AT5G66460 143 / 5e-41 MAN7, AtMAN7 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
AT3G10890 120 / 2e-32 Glycosyl hydrolase superfamily protein (.1)
AT5G01930 119 / 4e-32 MAN6, AtMAN6 endo-beta-mannase 6, Glycosyl hydrolase superfamily protein (.1)
AT3G10900 112 / 2e-29 Glycosyl hydrolase superfamily protein (.1)
AT4G28320 105 / 5e-27 MAN5, AtMAN5 endo-beta-mannase 5, Glycosyl hydrolase superfamily protein (.1)
AT2G20680 104 / 2e-26 MAN2, AtMAN2 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1)
AT3G30540 81 / 3e-18 Glycosyl hydrolase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007210 316 / 2e-108 AT5G66460 401 / 5e-138 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Lus10007211 258 / 1e-81 AT1G02310 405 / 4e-134 endo-beta-mannanase 1, Glycosyl hydrolase superfamily protein (.1)
Lus10007900 147 / 3e-42 AT5G66460 417 / 4e-143 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Lus10030347 147 / 4e-42 AT5G66460 422 / 2e-145 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Lus10025995 145 / 2e-40 AT5G66460 577 / 0.0 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Lus10014288 139 / 2e-39 AT5G66460 583 / 0.0 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Lus10014184 135 / 1e-37 AT5G01930 674 / 0.0 endo-beta-mannase 6, Glycosyl hydrolase superfamily protein (.1)
Lus10031650 115 / 2e-30 AT2G20680 655 / 0.0 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1)
Lus10033687 114 / 5e-30 AT2G20680 644 / 0.0 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G184500 190 / 2e-59 AT5G66460 447 / 5e-156 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Potri.005G229600 147 / 2e-42 AT5G66460 542 / 0.0 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Potri.006G109900 137 / 3e-38 AT5G01930 659 / 0.0 endo-beta-mannase 6, Glycosyl hydrolase superfamily protein (.1)
Potri.016G138600 136 / 3e-38 AT5G01930 683 / 0.0 endo-beta-mannase 6, Glycosyl hydrolase superfamily protein (.1)
Potri.005G120500 135 / 3e-38 AT5G66460 588 / 0.0 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Potri.007G022000 133 / 2e-37 AT5G66460 573 / 0.0 endo-beta-mannase 7, Glycosyl hydrolase superfamily protein (.1)
Potri.006G009400 110 / 2e-28 AT4G28320 430 / 2e-148 endo-beta-mannase 5, Glycosyl hydrolase superfamily protein (.1)
Potri.013G130400 108 / 5e-28 AT2G20680 661 / 0.0 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1)
Potri.019G070200 106 / 1e-27 AT3G10890 302 / 3e-100 Glycosyl hydrolase superfamily protein (.1)
Potri.016G014801 89 / 8e-22 AT2G20680 231 / 2e-74 endo-beta-mannase 2, Glycosyl hydrolase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10010089 pacid=23158860 polypeptide=Lus10010089 locus=Lus10010089.g ID=Lus10010089.BGIv1.0 annot-version=v1.0
ATGGCAGCCTACCTTAAATCAATCGACGGTTGCCATATGCTTGAAGTAGGGCTCAAAGGATTCTACGGCCCTTCCAACCAAAACCTCAATCCTAACAACT
GGCCTTTCGGCACTGATTTCCTCTCCAACAATCAGATCCCTTTCATCGACTTTGCTACTACTCATCTTTATGCTGATCTATGGTTGCTGAATTCAACCGA
GACTCAAATAGAAGCATACGTGGACAAGTTTCTGGAATCTCGCATCCAAGACCGCAACACAGTGATCGGTAAGCCACTGGTGATGGAAGAATTTGGAAAA
TCCTTTAAGCAACATTGGTATAGCTTGGCAGTTAGGGATGCTTACTACAGCAAGATCTATAACTCCATCTACAACAGTTCTAAGCAAGGAGGATCCTTTG
CTGGTGGGATCTTCTGGCAGCTCCTGAATCCTGAAATGGACATTTGGGGAGATGGCTATCAAATTGTCCTTCAAAACAGCCCTTCTACTGCTTCCATCAT
TGCTCAACAATCTAAAAGGCTCTCTACTCTACCTGCTGTTATATCCTACTAA
AA sequence
>Lus10010089 pacid=23158860 polypeptide=Lus10010089 locus=Lus10010089.g ID=Lus10010089.BGIv1.0 annot-version=v1.0
MAAYLKSIDGCHMLEVGLKGFYGPSNQNLNPNNWPFGTDFLSNNQIPFIDFATTHLYADLWLLNSTETQIEAYVDKFLESRIQDRNTVIGKPLVMEEFGK
SFKQHWYSLAVRDAYYSKIYNSIYNSSKQGGSFAGGIFWQLLNPEMDIWGDGYQIVLQNSPSTASIIAQQSKRLSTLPAVISY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G02310 MAN1 endo-beta-mannanase 1, Glycosy... Lus10010089 0 1
AT2G16730 BGAL13 beta-galactosidase 13, glycosy... Lus10020877 10.6 0.7636
Lus10028090 17.0 0.7316
AT1G59950 NAD(P)-linked oxidoreductase s... Lus10039266 19.0 0.7399
AT5G60740 ABCG28 ATP-binding cassette G28, ABC ... Lus10016115 19.0 0.7193
AT5G38260 Protein kinase superfamily pro... Lus10027119 22.3 0.7261
AT5G22900 ATCHX3 cation/H+ exchanger 3, ARABIDO... Lus10000154 26.8 0.6911
AT4G38190 ATCSLD4 ARABIDOPSIS THALIANA CELLULOSE... Lus10022982 27.2 0.7031
AT5G04620 BIO4, ATBIOF biotin 4, biotin F (.1.2) Lus10009662 28.0 0.7242
AT5G22260 MS1 male sterility 1, RING/FYVE/PH... Lus10030773 31.1 0.7085
AT3G27050 unknown protein Lus10032042 32.8 0.7244

Lus10010089 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.