Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G36720 202 / 2e-66 HVA22K HVA22-like protein K (.1) AT5G42560 74 / 6e-16 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) AT1G75700 69 / 8e-15 HVA22G HVA22-like protein G (.1) AT1G19950 68 / 9e-14 HVA22H HVA22-like protein H (ATHVA22H) (.1) AT5G62490 65 / 2e-13 ATHVA22B ARABIDOPSIS THALIANA HVA22 HOMOLOGUE B, HVA22 homologue B (.1) AT1G69700 57 / 3e-10 ATHVA22C HVA22 homologue C (.1) AT2G36020 55 / 3e-09 HVA22J HVA22-like protein J (.1) AT5G50720 53 / 3e-09 ATHVA22E ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) AT4G24960 52 / 6e-09 ATHVA22D ARABIDOPSIS THALIANA HVA22 HOMOLOGUE D, HVA22 homologue D (.1.2.3) AT2G42820 53 / 8e-09 HVA22F HVA22-like protein F (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007215 [exp] 317 / 3e-112 AT4G36720 196 / 2e-64 HVA22-like protein K (.1) Lus10034519 [exp] 69 / 6e-14 AT5G42560 324 / 2e-111 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Lus10033152 [exp] 69 / 7e-14 AT5G42560 328 / 7e-113 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Lus10016974 [exp] 66 / 3e-13 AT2G36020 210 / 2e-68 HVA22-like protein J (.1) Lus10024332 [exp] 67 / 4e-13 AT5G42560 330 / 9e-114 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Lus10021299 [exp] 64 / 1e-12 AT2G36020 206 / 6e-67 HVA22-like protein J (.1) Lus10024234 [exp] 64 / 2e-12 AT1G74520 244 / 5e-83 HVA22 homologue A (.1) Lus10023605 [exp] 63 / 2e-12 AT1G74520 246 / 7e-84 HVA22 homologue A (.1) Lus10042193 [exp] 62 / 2e-11 AT5G39850 327 / 2e-108 Ribosomal protein S4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G113400 [exp] 239 / 3e-81 AT4G36720 241 / 1e-81 HVA22-like protein K (.1) Potri.007G029300 [exp] 201 / 9e-66 AT4G36720 252 / 2e-85 HVA22-like protein K (.1) Potri.005G237900 [exp] 69 / 6e-14 AT5G42560 274 / 1e-91 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Potri.016G072600 [exp] 64 / 8e-13 AT2G36020 210 / 9e-69 HVA22-like protein J (.1) Potri.002G023500 [exp] 65 / 1e-12 AT5G42560 296 / 2e-100 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Potri.006G205300 [exp] 64 / 2e-12 AT2G36020 228 / 1e-74 HVA22-like protein J (.1) Potri.004G166800 [exp] 63 / 4e-12 AT1G75700 234 / 3e-78 HVA22-like protein G (.1) Potri.012G069300 [exp] 57 / 3e-10 AT1G74520 259 / 1e-89 HVA22 homologue A (.1) Potri.015G062800 [exp] 55 / 2e-09 AT1G74520 255 / 4e-88 HVA22 homologue A (.1) Potri.014G148600 [exp] 51 / 1e-08 AT5G62490 87 / 1e-22 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE B, HVA22 homologue B (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03134 [flax] [poplar] TB2_DP1_HVA22 TB2/DP1, HVA22 family
Representative CDS sequence Show only first row Show all	>Lus10010093 pacid=23158927 polypeptide=Lus10010093 locus=Lus10010093.g ID=Lus10010093.BGIv1.0 annot-version=v1.0 ATGGCGTTCCCAGCTGAGGTTGGACTGCAGTTGCTTCTTTATCCACTCAATTCCAGTGTTGTTCTCAGAACAGCATGCTGTTCTGTAGGGATTGCTTTGC CTGTTTACACAACTTTCAAGGCGATTGAAAGGAAAGACCCAGATGAGCAAAGGAAATGTCTTGTTTACTGGGCAGCTTTTGGAGCTTTTAGTGTTGCAGA AGTGTTTACAGATAAGATCATTTCTTGGTTTCCAATGTACTATCATGCGAAGTTTGCGTTTCTCATTTGGCTGCAGCTTCCATCTATGAATGGAACCGGA GCTACAATTTTCTATTCAAAGTATCTACGTCCTTTCCTACTCAGGCATCAAGTCAGGCTTGACCACATCACAGAAATGGCAAATGGTCTGATGGCTAAAT TTATTCTTGCACACGAATCAGAATTCCGACTTGCGAAAGTGATTTTCACGAAGACTCTGGCATCAGTTCGGGAAACAATTCAACCAGTAGAACCACGGTC AACTGGCGGTGCCATTGAAGGTCCTCGGGACAGCGGACTGACTGAAGAGTCTCTATCGGATGTCGAAGATGAATGA
AA sequence Show only first row Show all	>Lus10010093 pacid=23158927 polypeptide=Lus10010093 locus=Lus10010093.g ID=Lus10010093.BGIv1.0 annot-version=v1.0 MAFPAEVGLQLLLYPLNSSVVLRTACCSVGIALPVYTTFKAIERKDPDEQRKCLVYWAAFGAFSVAEVFTDKIISWFPMYYHAKFAFLIWLQLPSMNGTG ATIFYSKYLRPFLLRHQVRLDHITEMANGLMAKFILAHESEFRLAKVIFTKTLASVRETIQPVEPRSTGGAIEGPRDSGLTEESLSDVEDE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G36720		HVA22K	HVA22-like protein K (.1)		Lus10010093 [exp]	0	1
AT3G02600		ATLPP3, LPP3	lipid phosphate phosphatase 3 ...		Lus10009155 [exp]	2.0	0.9193
AT1G51730			Ubiquitin-conjugating enzyme f...		Lus10037613 [exp]	2.2	0.9202
AT2G27790			RNA-binding (RRM/RBD/RNP motif...		Lus10030600 [exp]	4.0	0.9129
AT1G50575			Putative lysine decarboxylase ...		Lus10003762 [exp]	4.2	0.9150
AT3G05675			BTB/POZ domain-containing prot...		Lus10013580 [exp]	8.4	0.9057
AT1G07745		SSN1, ATRAD51D,...	SUPPRESOR OF SNI1, homolog of ...		Lus10005437 [exp]	8.5	0.9059
					Lus10014678 [exp]	8.8	0.9100
AT2G37680		PAT3, FRY1, FHY...	unknown protein		Lus10003966 [exp]	10.4	0.8459
AT3G51270			protein serine/threonine kinas...		Lus10013682 [exp]	12.0	0.9068
AT2G17900		ASHR1, SDG37	ASH1-related 1, SET domain gro...		Lus10029712 [exp]	12.4	0.8827

Compare expression of checked genes

Lus10010093 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.