Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G01575 59 / 2e-12 serine protease inhibitor, Kazal-type family protein (.1) AT3G61980 49 / 5e-09 serine protease inhibitor, Kazal-type family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010287 [exp] 80 / 4e-21 AT4G01575 72 / 2e-17 serine protease inhibitor, Kazal-type family protein (.1) Lus10009866 [exp] 78 / 3e-20 AT4G01575 70 / 1e-16 serine protease inhibitor, Kazal-type family protein (.1) Lus10009865 [exp] 69 / 6e-17 AT4G01575 56 / 3e-11 serine protease inhibitor, Kazal-type family protein (.1) Lus10030166 [exp] 61 / 2e-13 AT4G01575 134 / 2e-41 serine protease inhibitor, Kazal-type family protein (.1) Lus10007864 [exp] 61 / 3e-13 AT4G01575 129 / 4e-39 serine protease inhibitor, Kazal-type family protein (.1) Lus10010286 [exp] 53 / 8e-11 AT4G01575 63 / 3e-14 serine protease inhibitor, Kazal-type family protein (.1) Lus10010285 [exp] 50 / 2e-09 AT3G61980 66 / 3e-15 serine protease inhibitor, Kazal-type family protein (.1) Lus10030164 [exp] 48 / 1e-08 AT4G01575 59 / 8e-13 serine protease inhibitor, Kazal-type family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G108600 [exp] 63 / 4e-14 AT4G01575 104 / 1e-29 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G109000 [exp] 62 / 4e-14 AT3G61980 69 / 1e-16 serine protease inhibitor, Kazal-type family protein (.1) Potri.002G182800 [exp] 60 / 4e-13 AT4G01575 103 / 4e-29 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G108900 [exp] 58 / 1e-12 AT3G61980 67 / 5e-16 serine protease inhibitor, Kazal-type family protein (.1) Potri.015G001800 [exp] 55 / 7e-11 AT4G01575 83 / 4e-21 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G108800 [exp] 50 / 2e-09 AT4G01575 57 / 7e-12 serine protease inhibitor, Kazal-type family protein (.1) Potri.014G108700 [exp] 45 / 2e-07 AT3G61980 76 / 2e-19 serine protease inhibitor, Kazal-type family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010094 pacid=23158863 polypeptide=Lus10010094 locus=Lus10010094.g ID=Lus10010094.BGIv1.0 annot-version=v1.0 ATGGCGACAACAACGATGGCATGTCGTCGTCAAATGATGGTGTTGGTCGTTCTAGTGATAATGACGACGTCGGTGGAGGGGTGGGGATGGTACCATCGAA TCCCGTGCAAGGGGGTGGAGCAACCCCACGCGGATTCCTGCCCCGTTTCATGCCTCATTTCTGACCCGGTTTGCGGGAAAGACGGCAATACGTACTATTG TGGTTGCCTCGACGCTATGTGCTCCGGAACCAAGGCTGTGCGATATGGGGAGTGCTAA
AA sequence Show only first row Show all	>Lus10010094 pacid=23158863 polypeptide=Lus10010094 locus=Lus10010094.g ID=Lus10010094.BGIv1.0 annot-version=v1.0 MATTTMACRRQMMVLVVLVIMTTSVEGWGWYHRIPCKGVEQPHADSCPVSCLISDPVCGKDGNTYYCGCLDAMCSGTKAVRYGEC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G01575			serine protease inhibitor, Kaz...		Lus10010094 [exp]	0	1
AT3G36659			Plant invertase/pectin methyle...		Lus10002420 [exp]	1.0	0.8257
AT4G18540			unknown protein		Lus10008576 [exp]	9.0	0.7051
AT5G59700			Protein kinase superfamily pro...		Lus10023324 [exp]	13.6	0.7793
AT2G31050			Cupredoxin superfamily protein...		Lus10039842 [exp]	14.3	0.8029
AT3G51590		LTP12	lipid transfer protein 12 (.1)		Lus10004067 [exp]	22.4	0.7830
AT5G22820			ARM repeat superfamily protein...		Lus10005366 [exp]	24.1	0.7995
AT1G17930			Aminotransferase-like, plant m...		Lus10005482 [exp]	25.0	0.7830
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10022473 [exp]	27.4	0.7830
AT4G10950			SGNH hydrolase-type esterase s...		Lus10023070 [exp]	29.6	0.7830
AT1G34575			FAD-binding Berberine family p...		Lus10023373 [exp]	31.6	0.7830

Compare expression of checked genes

Lus10010094 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.