Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010102 pacid=23158851 polypeptide=Lus10010102 locus=Lus10010102.g ID=Lus10010102.BGIv1.0 annot-version=v1.0 ATGGAGAGGTTGCTTCAAGGCCCCATCAGTACTAGTCATACTGCCAATCCTCCTTCTCCTCCTCCTCCTCCATCTTCTTCTTGTGTGAGCAATATTTTGA CTGCTTTCAAGAAGAAGAAGAAGAAGAGCAGGAGGGAACACACTTCCATTACTATTCTCCAAGCTCCCCAAGCTTAG
AA sequence Show only first row Show all	>Lus10010102 pacid=23158851 polypeptide=Lus10010102 locus=Lus10010102.g ID=Lus10010102.BGIv1.0 annot-version=v1.0 MERLLQGPISTSHTANPPSPPPPPSSSCVSNILTAFKKKKKKSRREHTSITILQAPQA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10010102 [exp]	0	1
AT1G68780			RNI-like superfamily protein (...		Lus10038948 [exp]	4.6	0.8696
AT2G25737			Sulfite exporter TauE/SafE fam...		Lus10014316 [exp]	4.7	0.8829
					Lus10008514 [exp]	5.1	0.8286
AT5G50600		ATHSD1	hydroxysteroid dehydrogenase 1...		Lus10031448 [exp]	6.3	0.8687
AT5G55390		EDM2	ENHANCED DOWNY MILDEW 2 (.1.2)		Lus10002269 [exp]	6.8	0.8896
AT3G51250			Senescence/dehydration-associa...		Lus10041892 [exp]	7.5	0.7890
AT1G02205		CER1	ECERIFERUM 1, Fatty acid hydro...		Lus10011472 [exp]	10.0	0.8760
AT3G49950	GRAS		GRAS family transcription fact...		Lus10018498 [exp]	10.2	0.8821
AT3G61250	MYB	LMI2, ATMYB17	LATE MERISTEM IDENTITY2, myb d...		Lus10039214 [exp]	13.2	0.8718
					Lus10012394 [exp]	13.8	0.8555

Compare expression of checked genes

Lus10010102 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.