Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G46690 119 / 6e-36 SAUR-like auxin-responsive protein family (.1) AT3G61900 111 / 1e-32 SAUR-like auxin-responsive protein family (.1) AT4G00880 106 / 8e-31 SAUR-like auxin-responsive protein family (.1) AT5G53590 91 / 2e-24 SAUR-like auxin-responsive protein family (.1) AT4G12410 80 / 6e-20 SAUR-like auxin-responsive protein family (.1) AT4G22620 79 / 1e-19 SAUR-like auxin-responsive protein family (.1) AT2G45210 78 / 3e-19 SAUR-like auxin-responsive protein family (.1) AT3G03850 74 / 3e-18 SAUR-like auxin-responsive protein family (.1) AT2G21210 74 / 4e-18 SAUR-like auxin-responsive protein family (.1) AT3G43120 75 / 7e-18 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012613 [exp] 89 / 1e-24 AT2G46690 78 / 2e-20 SAUR-like auxin-responsive protein family (.1) Lus10032949 [exp] 89 / 1e-23 AT4G00880 104 / 9e-30 SAUR-like auxin-responsive protein family (.1) Lus10008845 [exp] 88 / 3e-23 AT2G46690 102 / 4e-29 SAUR-like auxin-responsive protein family (.1) Lus10030295 [exp] 84 / 2e-21 AT2G45210 131 / 1e-39 SAUR-like auxin-responsive protein family (.1) Lus10007560 [exp] 72 / 1e-17 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1) Lus10004337 [exp] 74 / 2e-17 AT4G12410 110 / 2e-31 SAUR-like auxin-responsive protein family (.1) Lus10012181 [exp] 72 / 4e-17 AT4G34770 97 / 3e-27 SAUR-like auxin-responsive protein family (.1) Lus10012185 [exp] 71 / 5e-17 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1) Lus10007564 [exp] 71 / 8e-17 AT4G34770 97 / 3e-27 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G176400 [exp] 115 / 2e-34 AT2G46690 145 / 2e-46 SAUR-like auxin-responsive protein family (.1) Potri.014G103300 [exp] 114 / 7e-34 AT2G46690 152 / 2e-49 SAUR-like auxin-responsive protein family (.1) Potri.012G023400 [exp] 103 / 2e-29 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1) Potri.015G006800 [exp] 98 / 1e-27 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1) Potri.002G145300 [exp] 80 / 7e-20 AT3G60690 174 / 4e-56 SAUR-like auxin-responsive protein family (.1) Potri.014G066900 [exp] 80 / 9e-20 AT3G60690 191 / 9e-63 SAUR-like auxin-responsive protein family (.1) Potri.006G278100 [exp] 80 / 9e-20 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1) Potri.003G113100 [exp] 77 / 8e-19 AT4G12410 149 / 1e-46 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 74 / 4e-18 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) Potri.009G126700 [exp] 73 / 8e-18 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10010110 pacid=23158875 polypeptide=Lus10010110 locus=Lus10010110.g ID=Lus10010110.BGIv1.0 annot-version=v1.0 ATGGGGAGCAGCGGTGGTGGGAGTACTGGAAGCCTTCGAAGCAAAAGCAAGGGGAATAATAATGCGGTTCCAAAGGGGTGTTTGGCTATAAAAGTCGGGC AATCAACGGAAGAGCAGCGGAGGTTCGTGGTTCCGGTGATGTATTTCAACCATCCGCTGTTCCTTCACCTGCTCAAGGGAGCGGAGGAGGAATATGGATT CGAGCATAAGGGAGCAATTACCATTCCTTGCCACGTGGAGGAATTCATTCATGTTCAGCGTATCATCGACGGGGACAAATCCGCCCACCACCACCATCAT CACTCCACCCCCCCCATCATCCCCCCAACAACACCACCAACCACATCGTCGGCTGTTTTAGGGTTTGATGACTAA
AA sequence Show only first row Show all	>Lus10010110 pacid=23158875 polypeptide=Lus10010110 locus=Lus10010110.g ID=Lus10010110.BGIv1.0 annot-version=v1.0 MGSSGGGSTGSLRSKSKGNNNAVPKGCLAIKVGQSTEEQRRFVVPVMYFNHPLFLHLLKGAEEEYGFEHKGAITIPCHVEEFIHVQRIIDGDKSAHHHHH HSTPPIIPPTTPPTTSSAVLGFDD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G46690			SAUR-like auxin-responsive pro...		Lus10010110 [exp]	0	1
AT1G28270		RALFL4	ralf-like 4 (.1)		Lus10015316 [exp]	3.0	0.9304
AT3G22970			Protein of unknown function (D...		Lus10003087 [exp]	4.1	0.9188
AT3G57450			unknown protein		Lus10029496 [exp]	4.7	0.9440
AT4G16820		PLA-I{beta]2	phospholipase A I beta 2, alph...		Lus10004364 [exp]	5.3	0.9332
AT5G07220		ATBAG3	BCL-2-associated athanogene 3 ...		Lus10023279 [exp]	8.2	0.9447
AT4G01070		UGT72B1, GT72B1	UDP-GLUCOSE-DEPENDENT GLUCOSYL...		Lus10029452 [exp]	8.5	0.9313
AT5G50160		ATFRO8, FRO8	ferric reduction oxidase 8 (.1...		Lus10019488 [exp]	10.5	0.8926
AT1G58070			unknown protein		Lus10019953 [exp]	13.3	0.9423
AT2G04305			Magnesium transporter CorA-lik...		Lus10010751 [exp]	15.7	0.9335
AT1G18740			Protein of unknown function (D...		Lus10018883 [exp]	16.0	0.9055

Compare expression of checked genes

Lus10010110 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.