Gene [FLAX] | FIBexDB

Lus10010115 [FLAX]

External link

Symbol

Arabidopsis homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	Alias	TAIR10 short description
AT5G48540	40 / 6e-05		receptor-like protein kinase-related family protein (.1)
AT4G05200	39 / 0.0002	CRK25	cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
AT1G04520	39 / 0.0002	PDLP2	plasmodesmata-located protein 2 (.1)
AT1G70690	39 / 0.0003	HWI1, PDLP5	PLASMODESMATA-LOCATED PROTEIN 5, HOPW1-1-INDUCED GENE1, Receptor-like protein kinase-related family protein (.1)
AT5G43980	39 / 0.0003	PDLP1, PDLP1A	PLASMODESMATA-LOCATED PROTEIN 1A, plasmodesmata-located protein 1 (.1)
AT2G33330	38 / 0.0004	PDLP3	plasmodesmata-located protein 3 (.1)

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10003759 [exp]	178 / 2e-59	ND	38 / 9e-04
Lus10010118 [exp]	166 / 2e-54	AT1G04520	40 / 3e-04	plasmodesmata-located protein 2 (.1)
Lus10028049 [exp]	159 / 1e-51	AT1G04520	38 / 9e-04	plasmodesmata-located protein 2 (.1)
Lus10012623 [exp]	155 / 5e-50	ND	38 / 0.001
Lus10003758 [exp]	140 / 5e-43	ND	/
Lus10028050 [exp]	99 / 1e-27	ND	36 / 0.004
Lus10014738 [exp]	94 / 5e-26	ND	/
Lus10035753 [exp]	94 / 3e-25	ND	/
Lus10008314 [exp]	92 / 5e-25	ND	/

Poplar homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Potri.005G208400 [exp]	44 / 2e-06	AT5G48540	52 / 1e-08	receptor-like protein kinase-related family protein (.1)
Potri.004G025425 [exp]	42 / 2e-05	AT4G21410	556 / 0.0	cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Potri.004G026200 [exp]	42 / 2e-05	AT4G05200	573 / 0.0	cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Potri.004G024000 [exp]	41 / 3e-05	AT4G23180	489 / 4e-165	cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G023964 [exp]	41 / 3e-05	AT4G23180	401 / 6e-132	cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G023700 [exp]	40 / 6e-05	AT4G05200	474 / 3e-159	cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Potri.002G257300 [exp]	40 / 0.0001	AT1G04520	243 / 2e-79	plasmodesmata-located protein 2 (.1)
Potri.010G065800 [exp]	39 / 0.0002	AT1G04520	337 / 2e-116	plasmodesmata-located protein 2 (.1)
Potri.011G028100 [exp]	39 / 0.0002	AT4G05200	519 / 8e-177	cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Potri.004G023876 [exp]	39 / 0.0002	AT4G23180	489 / 5e-165	cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)

PFAM info

Clan ID	Clan name	Pfam ID	Pfam name	Pfam description
		PF01657 [flax] [poplar]	Stress-antifung	Salt stress response/antifungal

Representative CDS sequence

Show only first row Show all

>Lus10010115 pacid=23158920 polypeptide=Lus10010115 locus=Lus10010115.g ID=Lus10010115.BGIv1.0 annot-version=v1.0

ATGGTCAAGCCTGGTTGTACAGGTGTTGAAACTGCGAGCAAGAAATTCGACAAGTACGTGGCGCACCTGCTGGATTTTCTGGTAGCCGAGACGAAGAACG

TGTATAGGAACAAGGACGGGAGTTATACGTACAATCACAGCTACCCTGATCCGGATTCAGAGTCGGCTAATGGGGTGGGGAACTGTAGTAGAGAGCTTGC

GAAGTTAGATTGTTGGTCGTGTCTCCGAAGTGCCAAGGACAAGGTCAAGTCGGCTTGCCACGAGGCTGTAGGTGGTAGTGTCACTCTCAAGGATTGCTCC

ATCTCCTTCAACCTCATTCCTTAA

AA sequence

Show only first row Show all

>Lus10010115 pacid=23158920 polypeptide=Lus10010115 locus=Lus10010115.g ID=Lus10010115.BGIv1.0 annot-version=v1.0

MVKPGCTGVETASKKFDKYVAHLLDFLVAETKNVYRNKDGSYTYNHSYPDPDSESANGVGNCSRELAKLDCWSCLRSAKDKVKSACHEAVGGSVTLKDCS

ISFNLIP

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G48540			receptor-like protein kinase-r...		Lus10010115 [exp]	0	1

Lus10010115 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.