Lus10010116 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012621 261 / 7e-91 ND 38 / 0.002
Lus10003758 224 / 1e-75 ND /
Lus10010117 186 / 1e-61 ND 39 / 4e-04
Lus10028048 184 / 1e-60 ND /
Lus10003757 182 / 7e-60 ND /
Lus10014738 157 / 2e-50 ND /
Lus10002731 145 / 1e-45 ND /
Lus10035753 116 / 2e-33 ND /
Lus10008314 114 / 4e-33 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G208400 40 / 0.0001 AT5G48540 52 / 1e-08 receptor-like protein kinase-related family protein (.1)
PFAM info
Representative CDS sequence
>Lus10010116 pacid=23158898 polypeptide=Lus10010116 locus=Lus10010116.g ID=Lus10010116.BGIv1.0 annot-version=v1.0
ATGTATTGCTGGTACAAACTGCATGCGATACCTGCAGCAGCAGCAGCAGCAGCAGTGATTATGCTTATCGGTATACTTTCCATCAGCGTCGTCGTCGAGG
GCAAGTTCCCCGACACGACCATCCTCAGCGGTCCGAATTGCACCGGGAAATCGACCACGAAGAAGTACAATGACAATGTGATGCATCTCCTCGATACGTT
TGTGAAGGACACAAAGATAAGCAGAAGGAATATTTACGGAGATCGACAGATGAACCATAGTCATCCGAATCGAAACCCGGGGTCGCCTTATGGTGAATCG
GTTTGCTACCAAGACCTTGGAAGGCTAGACTGTTTCAATTGTCTGTTCAATGCTAAGGGCAAAATCGGCAATGGTTGCTTGCACCCGATTGCTGCTAGCA
TCAAACTCCAGGACTGCTCCATTTGGTTCAATGCCCACCCTTAA
AA sequence
>Lus10010116 pacid=23158898 polypeptide=Lus10010116 locus=Lus10010116.g ID=Lus10010116.BGIv1.0 annot-version=v1.0
MYCWYKLHAIPAAAAAAAVIMLIGILSISVVVEGKFPDTTILSGPNCTGKSTTKKYNDNVMHLLDTFVKDTKISRRNIYGDRQMNHSHPNRNPGSPYGES
VCYQDLGRLDCFNCLFNAKGKIGNGCLHPIAASIKLQDCSIWFNAHP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10010116 0 1
AT5G23960 ATTPS21 terpene synthase 21 (.1.2) Lus10031589 1.0 0.8964
Lus10003840 9.1 0.8729
AT3G21120 F-box and associated interacti... Lus10040800 9.6 0.7782
Lus10022573 11.1 0.8729
Lus10034050 11.3 0.6143
AT2G18370 Bifunctional inhibitor/lipid-t... Lus10001431 12.8 0.8729
Lus10006661 14.3 0.8729
AT5G67210 IRX15-L IRX15-LIKE, Protein of unknown... Lus10009378 15.7 0.8729
AT4G33270 AtCDC20.1, CDC2... cell division cycle 20.1, Tran... Lus10038264 16.9 0.8729
Lus10012429 18.1 0.8729

Lus10010116 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.