Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01280 176 / 1e-53 CYP703A2 "cytochrome P450, family 703, subfamily A, polypeptide 2", cytochrome P450, family 703, subfamily A, polypeptide 2 (.1) AT3G26210 104 / 6e-27 CYP71B23 "cytochrome P450, family 71, subfamily B, polypeptide 23", cytochrome P450, family 71, subfamily B, polypeptide 23 (.1) AT2G22330 96 / 1e-23 CYP79B3 "cytochrome P450, family 79, subfamily B, polypeptide 3", cytochrome P450, family 79, subfamily B, polypeptide 3 (.1) AT3G26830 95 / 1e-23 CYP71B15, PAD3 PHYTOALEXIN DEFICIENT 3, Cytochrome P450 superfamily protein (.1) AT1G13090 95 / 2e-23 CYP71B28 "cytochrome P450, family 71, subfamily B, polypeptide 28", cytochrome P450, family 71, subfamily B, polypeptide 28 (.1) AT4G39950 94 / 3e-23 CYP79B2 "cytochrome P450, family 79, subfamily B, polypeptide 2", cytochrome P450, family 79, subfamily B, polypeptide 2 (.1) AT1G13100 92 / 1e-22 CYP71B29 "cytochrome P450, family 71, subfamily B, polypeptide 29", cytochrome P450, family 71, subfamily B, polypeptide 29 (.1) AT3G26330 92 / 2e-22 CYP71B37 "cytochrome P450, family 71, subfamily B, polypeptide 37", cytochrome P450, family 71, subfamily B, polypeptide 37 (.1) AT1G13110 91 / 3e-22 CYP71B7 "cytochrome P450, family 71 subfamily B, polypeptide 7", cytochrome P450, family 71 subfamily B, polypeptide 7 (.1) AT2G40890 91 / 4e-22 REF8, CYP98A3, C3H1 cytochrome P450, family 98, subfamily A, polypeptide 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012624 [exp] 207 / 2e-65 AT1G01280 769 / 0.0 "cytochrome P450, family 703, subfamily A, polypeptide 2", cytochrome P450, family 703, subfamily A, polypeptide 2 (.1) Lus10023142 [exp] 102 / 3e-27 AT4G39950 345 / 4e-116 "cytochrome P450, family 79, subfamily B, polypeptide 2", cytochrome P450, family 79, subfamily B, polypeptide 2 (.1) Lus10031151 [exp] 95 / 2e-23 AT4G39950 603 / 0.0 "cytochrome P450, family 79, subfamily B, polypeptide 2", cytochrome P450, family 79, subfamily B, polypeptide 2 (.1) Lus10023144 [exp] 95 / 2e-23 AT4G39950 604 / 0.0 "cytochrome P450, family 79, subfamily B, polypeptide 2", cytochrome P450, family 79, subfamily B, polypeptide 2 (.1) Lus10023143 [exp] 95 / 2e-23 AT4G39950 605 / 0.0 "cytochrome P450, family 79, subfamily B, polypeptide 2", cytochrome P450, family 79, subfamily B, polypeptide 2 (.1) Lus10031145 [exp] 93 / 7e-23 AT4G39950 561 / 0.0 "cytochrome P450, family 79, subfamily B, polypeptide 2", cytochrome P450, family 79, subfamily B, polypeptide 2 (.1) Lus10038200 [exp] 92 / 1e-22 AT4G31940 451 / 2e-154 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1) Lus10035502 [exp] 92 / 1e-22 AT5G06900 533 / 0.0 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Lus10025902 [exp] 92 / 1e-22 AT4G31940 449 / 1e-153 "cytochrome P450, family 82, subfamily C, polypeptide 4", cytochrome P450, family 82, subfamily C, polypeptide 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G171800 [exp] 192 / 1e-59 AT1G01280 778 / 0.0 "cytochrome P450, family 703, subfamily A, polypeptide 2", cytochrome P450, family 703, subfamily A, polypeptide 2 (.1) Potri.007G084200 [exp] 108 / 2e-28 AT3G26300 385 / 1e-129 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G084400 [exp] 103 / 2e-27 AT4G36220 267 / 2e-85 ferulic acid 5-hydroxylase 1 (.1) Potri.007G084800 [exp] 105 / 3e-27 AT3G26300 380 / 3e-127 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G085000 [exp] 105 / 3e-27 AT5G07990 402 / 5e-135 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1) Potri.007G084700 [exp] 104 / 5e-27 AT5G07990 397 / 5e-134 TRANSPARENT TESTA 7, CYTOCHROME P450 75B1, Cytochrome P450 superfamily protein (.1) Potri.007G083000 [exp] 104 / 5e-27 AT3G26330 368 / 8e-123 "cytochrome P450, family 71, subfamily B, polypeptide 37", cytochrome P450, family 71, subfamily B, polypeptide 37 (.1) Potri.012G090000 [exp] 103 / 1e-26 AT3G26330 433 / 5e-148 "cytochrome P450, family 71, subfamily B, polypeptide 37", cytochrome P450, family 71, subfamily B, polypeptide 37 (.1) Potri.007G082900 [exp] 100 / 1e-25 AT3G26300 377 / 2e-126 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.012G089900 [exp] 100 / 1e-25 AT3G48280 429 / 1e-146 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10010119 pacid=23158899 polypeptide=Lus10010119 locus=Lus10010119.g ID=Lus10010119.BGIv1.0 annot-version=v1.0 ATGCCGTTACGTAAGGCTTACGTCAGGAGAGTCGTTTATTATGTAACATGCAAATTTTGCCTGATAAAACACACACGCGTCCGCTGCAAAATCCAACAAG AAATCGATTCTGTGGTGGGTCGTGATCAAGTCAAAGAATCAGACTTGACTCAACTCAATTACTTGCGATGCGTCGTACGAGAAACCTTCAGTACGCATCC GGCGGGCCCACTCCTAATTCCTCACGAGTCTCTACGCGCCACCACCATCAACAGCTATTACATCCCTGCCAAGGCCCGAGTCTTCATCAACACCCACGGG CTGGGCCGGAACACCGAGTTATGGGCCGACGTTGATGATTTTCGGCCCGAGAGACACTGGCTGGATGACGGAAGCCGAGTGGAGATTAGCCACGGAAGCC GATTTCAAGATCCTGCCGTTTAG
AA sequence Show only first row Show all	>Lus10010119 pacid=23158899 polypeptide=Lus10010119 locus=Lus10010119.g ID=Lus10010119.BGIv1.0 annot-version=v1.0 MPLRKAYVRRVVYYVTCKFCLIKHTRVRCKIQQEIDSVVGRDQVKESDLTQLNYLRCVVRETFSTHPAGPLLIPHESLRATTINSYYIPAKARVFINTHG LGRNTELWADVDDFRPERHWLDDGSRVEISHGSRFQDPAV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G01280		CYP703A2	"cytochrome P450, family 703, ...		Lus10010119 [exp]	0	1
AT1G48020		ATPMEI1	ARABIDOPSIS THALIANA PECTIN ME...		Lus10001658 [exp]	1.4	1.0000
AT5G39130			RmlC-like cupins superfamily p...		Lus10015129 [exp]	2.0	1.0000
AT5G01180		ATPTR5	ARABIDOPSIS THALIANA PEPTIDE T...		Lus10017177 [exp]	2.4	1.0000
					Lus10017294 [exp]	2.8	1.0000
AT3G54700		PHT1;7	phosphate transporter 1;7 (.1)		Lus10022934 [exp]	3.2	0.9572
AT4G04960			Concanavalin A-like lectin pro...		Lus10039837 [exp]	3.2	1.0000
					Lus10003941 [exp]	3.7	1.0000
AT1G29050		TBL38	TRICHOME BIREFRINGENCE-LIKE 38...		Lus10039560 [exp]	4.2	1.0000
AT1G61110	NAC	ANAC025	NAC domain containing protein ...		Lus10003847 [exp]	4.4	0.8056
AT1G04110		SDD1	STOMATAL DENSITY AND DISTRIBUT...		Lus10027892 [exp]	4.9	1.0000

Compare expression of checked genes

Lus10010119 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.