Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G25409 64 / 3e-14 unknown protein AT2G25410 64 / 2e-13 RING/U-box superfamily protein (.1) AT1G28040 57 / 7e-11 RING/U-box superfamily protein (.1) AT2G46495 54 / 7e-10 RING/U-box superfamily protein (.1) AT5G53110 52 / 4e-09 RING/U-box superfamily protein (.1) AT2G46494 50 / 3e-08 RING/U-box superfamily protein (.1) AT5G07040 48 / 7e-08 RING/U-box superfamily protein (.1) AT2G46493 44 / 3e-06 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012628 [exp] 126 / 4e-36 AT5G53110 284 / 5e-93 RING/U-box superfamily protein (.1) Lus10023086 [exp] 63 / 7e-13 AT5G53110 161 / 1e-59 RING/U-box superfamily protein (.1) Lus10032382 [exp] 60 / 7e-12 AT5G53110 237 / 1e-74 RING/U-box superfamily protein (.1) Lus10005389 [exp] 52 / 1e-09 AT5G07040 154 / 9e-49 RING/U-box superfamily protein (.1) Lus10019018 [exp] 53 / 2e-09 AT5G53110 332 / 4e-112 RING/U-box superfamily protein (.1) Lus10003400 [exp] 46 / 2e-07 AT5G53110 152 / 3e-45 RING/U-box superfamily protein (.1) Lus10024124 [exp] 44 / 2e-06 AT5G07040 190 / 2e-62 RING/U-box superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G098200 [exp] 74 / 5e-17 AT2G46495 290 / 1e-95 RING/U-box superfamily protein (.1) Potri.002G170300 [exp] 73 / 2e-16 AT2G46495 317 / 4e-106 RING/U-box superfamily protein (.1) Potri.001G032300 [exp] 55 / 1e-10 AT5G07040 143 / 5e-44 RING/U-box superfamily protein (.1) Potri.003G192700 [exp] 55 / 2e-10 AT5G07040 194 / 3e-64 RING/U-box superfamily protein (.1) Potri.003G139900 [exp] 51 / 8e-09 AT5G53110 253 / 3e-81 RING/U-box superfamily protein (.1) Potri.001G091700 [exp] 46 / 6e-07 AT5G53110 223 / 1e-69 RING/U-box superfamily protein (.1) Potri.015G017800 [exp] 42 / 1e-05 AT5G53110 389 / 1e-134 RING/U-box superfamily protein (.1) Potri.012G011500 [exp] 41 / 4e-05 AT5G53110 353 / 2e-120 RING/U-box superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010124 pacid=23158878 polypeptide=Lus10010124 locus=Lus10010124.g ID=Lus10010124.BGIv1.0 annot-version=v1.0 ATGCAATCAGCATGGAAGCAGCGCTTACATTCTGGTATTAATCTGATGGTGTCTTTCCCGCAATACTCTGTCATGCAGATGGCGCAAACGATGTCGTTTG GTCTGGGCACTCGCTTGCTTTCTCCCAGCACTACTTTCTCTTATGATTCGATGGTGGATTCGTCCAATCCCAACGTAACCACCGTCCCCGGTTCAGGCGT CACTGCCGCCGTTGTGATTGGCGGCGTCCGTTTTGAAGGAAAAGGCGAAGCATGCAATTCCAAAAGCACAGGTTGCTGCTGGAATGGCGAGGGATAA
AA sequence Show only first row Show all	>Lus10010124 pacid=23158878 polypeptide=Lus10010124 locus=Lus10010124.g ID=Lus10010124.BGIv1.0 annot-version=v1.0 MQSAWKQRLHSGINLMVSFPQYSVMQMAQTMSFGLGTRLLSPSTTFSYDSMVDSSNPNVTTVPGSGVTAAVVIGGVRFEGKGEACNSKSTGCCWNGEG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G25409			unknown protein		Lus10010124 [exp]	0	1
AT1G23890			NHL domain-containing protein ...		Lus10030849 [exp]	11.8	0.6032
AT3G25820		ATTPS-CIN	"terpene synthase-like sequenc...		Lus10000476 [exp]	19.4	0.5691
AT3G60850			unknown protein		Lus10004021 [exp]	23.8	0.5823
ATCG00900		ATCG00900.1, RP...	CHLOROPLAST RIBOSOMAL PROTEIN ...		Lus10000168 [exp]	161.0	0.4630
ATCG00900		ATCG00900.1, RP...	CHLOROPLAST RIBOSOMAL PROTEIN ...		Lus10002395 [exp]	161.3	0.4630

Compare expression of checked genes

Lus10010124 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.