Lus10010147 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18196 165 / 9e-52 Heavy metal transport/detoxification superfamily protein (.1)
AT4G10465 153 / 3e-47 Heavy metal transport/detoxification superfamily protein (.1)
AT1G61570 88 / 6e-23 TIM13 translocase of the inner mitochondrial membrane 13 (.1)
AT1G06330 88 / 4e-22 Heavy metal transport/detoxification superfamily protein (.1)
AT3G56891 84 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1)
AT1G71050 76 / 2e-17 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1)
AT1G22990 69 / 6e-15 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1)
AT1G29100 69 / 7e-15 Heavy metal transport/detoxification superfamily protein (.1)
AT4G08570 68 / 2e-14 Heavy metal transport/detoxification superfamily protein (.1)
AT5G17450 66 / 4e-14 HIPP21 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008284 176 / 6e-56 AT2G18196 246 / 4e-84 Heavy metal transport/detoxification superfamily protein (.1)
Lus10033250 176 / 6e-56 AT2G18196 251 / 3e-86 Heavy metal transport/detoxification superfamily protein (.1)
Lus10017352 129 / 1e-38 AT1G61570 92 / 6e-26 translocase of the inner mitochondrial membrane 13 (.1)
Lus10001892 89 / 4e-22 AT1G06330 101 / 1e-27 Heavy metal transport/detoxification superfamily protein (.1)
Lus10020704 87 / 2e-21 AT1G06330 173 / 3e-56 Heavy metal transport/detoxification superfamily protein (.1)
Lus10013911 85 / 2e-20 AT1G06330 103 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1)
Lus10042946 72 / 6e-16 AT1G71050 196 / 3e-65 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1)
Lus10022508 72 / 8e-16 AT4G39700 201 / 2e-67 Heavy metal transport/detoxification superfamily protein (.1)
Lus10016812 72 / 8e-16 AT4G39700 181 / 3e-59 Heavy metal transport/detoxification superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G452400 176 / 2e-56 AT2G18196 256 / 3e-88 Heavy metal transport/detoxification superfamily protein (.1)
Potri.011G149500 172 / 8e-55 AT2G18196 257 / 9e-89 Heavy metal transport/detoxification superfamily protein (.1)
Potri.006G024800 107 / 1e-29 AT3G56891 167 / 5e-54 Heavy metal transport/detoxification superfamily protein (.1)
Potri.011G065600 105 / 8e-29 AT1G06330 159 / 7e-51 Heavy metal transport/detoxification superfamily protein (.1)
Potri.001G452100 100 / 7e-28 AT1G61570 76 / 2e-19 translocase of the inner mitochondrial membrane 13 (.1)
Potri.011G149800 100 / 2e-27 AT1G61570 77 / 3e-20 translocase of the inner mitochondrial membrane 13 (.1)
Potri.019G106500 91 / 3e-23 AT1G06330 217 / 1e-73 Heavy metal transport/detoxification superfamily protein (.1)
Potri.019G107500 87 / 8e-22 AT1G06330 213 / 5e-72 Heavy metal transport/detoxification superfamily protein (.1)
Potri.004G056800 82 / 7e-20 AT1G06330 147 / 4e-46 Heavy metal transport/detoxification superfamily protein (.1)
Potri.010G114600 76 / 2e-17 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00403 HMA Heavy-metal-associated domain
PF02953 zf-Tim10_DDP Tim10/DDP family zinc finger
Representative CDS sequence
>Lus10010147 pacid=23154180 polypeptide=Lus10010147 locus=Lus10010147.g ID=Lus10010147.BGIv1.0 annot-version=v1.0
ATGTGCTGCAATGGCTGCGAGAGAGTTGTAAAGAAAGCCATTCGCAAGCTCAGAGGGGTTGATTCGGTGGAGGTGGAGTTGGAGATGGAGAAAGTGACGG
TGGTCGGCTACGTGGAACGGAACAAGGTGCTCAAGGCGGTTAGAAGATCCGGAAAGAGAGCCGAGTTCTGGCCGTACCCGAATCCGCCTCTCTTCTTCAC
GTCGGCCGAAGATTACTTCAAGGACACGGCAAACGAGTTCAAGGAGAGCTACAACTACTACCGCCACGGCTACAACAAAGCGGAAGCGGAAGAAGAGCCG
AGCAAACGAGCTTACAGCCAGAGAGAGAGAGAGAGAGAGATCGATACAGAGCTATCAGCGATGGATTTCTCCCAACCAGGACACAGTAGTTCAAACATAT
CTTCGGAGGATTTCAAGGATCAGTTCAAGACTCAACTCGCCCAGGCCTACGCCCAAGAATTCCTCGAGACATTGGGAACGAAGTGTTTCGACAAGTGCGT
GACGAAGCCGGGATCGAGCCTGAGCGGGAGCGAAAGCAGCTGTGTCTCCAGGTGTGTGGATCGCTACATCGAAGCCACTGGCTTAGTTAGCAGAGCTCTC
TTTAACGCTCCCCGCTGA
AA sequence
>Lus10010147 pacid=23154180 polypeptide=Lus10010147 locus=Lus10010147.g ID=Lus10010147.BGIv1.0 annot-version=v1.0
MCCNGCERVVKKAIRKLRGVDSVEVELEMEKVTVVGYVERNKVLKAVRRSGKRAEFWPYPNPPLFFTSAEDYFKDTANEFKESYNYYRHGYNKAEAEEEP
SKRAYSQREREREIDTELSAMDFSQPGHSSSNISSEDFKDQFKTQLAQAYAQEFLETLGTKCFDKCVTKPGSSLSGSESSCVSRCVDRYIEATGLVSRAL
FNAPR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G18196 Heavy metal transport/detoxifi... Lus10010147 0 1
AT3G23390 Zinc-binding ribosomal protein... Lus10040983 2.2 0.9068
AT1G26880 Ribosomal protein L34e superfa... Lus10036750 4.0 0.8973
AT5G60340 P-loop containing nucleoside t... Lus10016525 4.2 0.8282
AT3G23390 Zinc-binding ribosomal protein... Lus10013436 4.9 0.8947
AT3G53740 Ribosomal protein L36e family ... Lus10016501 5.3 0.8897
AT5G60340 P-loop containing nucleoside t... Lus10040792 5.3 0.8380
AT3G47120 C3HZnF RNA recognition motif (RRM)-co... Lus10018227 5.7 0.8472
AT5G47890 NADH-ubiquinone oxidoreductase... Lus10040122 6.3 0.8626
AT3G52040 unknown protein Lus10039586 6.9 0.8674
AT5G65860 ankyrin repeat family protein ... Lus10032850 7.0 0.8650

Lus10010147 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.