Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19960 171 / 7e-51 ATM1, ATATM myosin 1 (.1.2) AT1G50360 160 / 3e-47 ATVIIIA, VIIIA MYOSIN VIII A, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G54280 76 / 3e-17 ATMYOS1, ATM4, ATATM2, ATM2 ARABIDOPSIS THALIANA MYOSIN 1, ARABIDOPSIS THALIANA MYOSIN 4, myosin 2 (.1.2) AT4G27370 67 / 2e-14 ATVIIIB, TVIIIB, VIIIB MYOSIN VIII B, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017377 [exp] 201 / 2e-61 AT3G19960 1806 / 0.0 myosin 1 (.1.2) Lus10040996 [exp] 167 / 2e-49 AT3G19960 1049 / 0.0 myosin 1 (.1.2) Lus10013443 [exp] 163 / 4e-48 AT3G19960 1748 / 0.0 myosin 1 (.1.2) Lus10037876 [exp] 70 / 4e-15 AT5G54280 1383 / 0.0 ARABIDOPSIS THALIANA MYOSIN 1, ARABIDOPSIS THALIANA MYOSIN 4, myosin 2 (.1.2) Lus10038576 [exp] 69 / 5e-15 AT5G54280 1378 / 0.0 ARABIDOPSIS THALIANA MYOSIN 1, ARABIDOPSIS THALIANA MYOSIN 4, myosin 2 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G089200 [exp] 167 / 2e-49 AT3G19960 1896 / 0.0 myosin 1 (.1.2) Potri.007G074800 [exp] 158 / 2e-46 AT3G19960 1899 / 0.0 myosin 1 (.1.2) Potri.001G407000 [exp] 97 / 9e-25 AT5G54280 1513 / 0.0 ARABIDOPSIS THALIANA MYOSIN 1, ARABIDOPSIS THALIANA MYOSIN 4, myosin 2 (.1.2) Potri.011G126800 [exp] 94 / 1e-23 AT5G54280 1519 / 0.0 ARABIDOPSIS THALIANA MYOSIN 1, ARABIDOPSIS THALIANA MYOSIN 4, myosin 2 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10010172 pacid=23154251 polypeptide=Lus10010172 locus=Lus10010172.g ID=Lus10010172.BGIv1.0 annot-version=v1.0 ATGAATGCCGGTTTGAGTGTTATAAGCCGGTTGGCCGAAGAATTCGAGCAGAGAAGTCAAGTGTTCGGAGACGATGCCAAGTTCTTGGTCGAGGTGAGAT CCGGCCAGGTGGAAGCAAACTTGAACCCGGATCGAGAGCTTAGAAGGTTGAAAGCGATGTTCGAGAGCTGGAAGAAGGATTATAGCGCGAGATTACGAGA AACAAAGGTGGTATTGAACAAGCTTGCGAGCGAAGAAAGCGCGAGCGCTGTCGAGAAAGTGAGGAAGAAATGGTGGGGGAGGTTGAACAGCACTAGGCAT ATTTGA
AA sequence Show only first row Show all	>Lus10010172 pacid=23154251 polypeptide=Lus10010172 locus=Lus10010172.g ID=Lus10010172.BGIv1.0 annot-version=v1.0 MNAGLSVISRLAEEFEQRSQVFGDDAKFLVEVRSGQVEANLNPDRELRRLKAMFESWKKDYSARLRETKVVLNKLASEESASAVEKVRKKWWGRLNSTRH I

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G19960		ATM1, ATATM	myosin 1 (.1.2)		Lus10010172 [exp]	0	1
AT2G36680			Modifier of rudimentary (Mod(r...		Lus10023888 [exp]	1.0	0.8645
AT3G24050	GATA	GATA1	GATA transcription factor 1 (....		Lus10023684 [exp]	2.4	0.8285
AT1G10940		ASK1, SNRK2-4, ...	SNF1-related protein kinase 2....		Lus10019225 [exp]	2.8	0.8371
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Lus10023428 [exp]	4.2	0.8569
AT5G45840			Leucine-rich repeat protein ki...		Lus10007516 [exp]	4.2	0.7967
AT5G42000			ORMDL family protein (.1.2)		Lus10023031 [exp]	4.9	0.8126
AT2G40830		RHC1A	RING-H2 finger C1A (.1.2.3)		Lus10001582 [exp]	5.9	0.8268
AT3G16175			Thioesterase superfamily prote...		Lus10006837 [exp]	6.5	0.8386
AT1G17180		ATGSTU25	glutathione S-transferase TAU ...		Lus10019480 [exp]	8.7	0.8295
AT4G10020		ATHSD5	hydroxysteroid dehydrogenase 5...		Lus10009467 [exp]	13.0	0.8024

Compare expression of checked genes

Lus10010172 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.