Plant FIBer expression Database

Lus10010176 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G23290 209 / 7e-71 PFD5, PDF5 prefoldin 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017381
[exp]
237 / 2e-81 AT5G23290 211 / 6e-71 prefoldin 5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G090100
[exp]
219 / 9e-75 AT5G23290 236 / 6e-81 prefoldin 5 (.1)
Potri.007G074042
[exp]
216 / 1e-73 AT5G23290 231 / 4e-79 prefoldin 5 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0200 Prefoldin PF02996 Prefoldin Prefoldin subunit
Representative CDS sequence
>Lus10010176 pacid=23154189 polypeptide=Lus10010176 locus=Lus10010176.g ID=Lus10010176.BGIv1.0 annot-version=v1.0
ATGGACAAGTTGACCGTGGAACAACTTAAGGCGTTGAAGGAGCAGACGGATCTAGAGGTCAATCTCTTGCAAGACAGCCTCACCAACATCCGCACCGCCA
CCACTCGCCTCGATCTCGCGTCCTCCGCCCTCCACGATCTCTCCCTCCGCCCCCAAGGTAAGAAAATGCTGGTCCCTCTTACTGCATCACTCTACGTCCC
TGGAACTCTCGATGATTCCGATAATGTCCTCGTCGATATCGGCACCGGTTATTTCGTCGAGAAAACAATGGTTGAAGGGAAAGATTACTGCGAAAGGAAG
ATCAACTTGCTCAAATCCAATTACGATCAACTTCTCGAGCTTGCATCGAAGAAGAAGAGCGTTGCAGACGAAGCAGGGGTGGTCTTGCAGGCTAAGTTGA
AACAGATGGCGGCACCATCGCCGTAG
AA sequence
>Lus10010176 pacid=23154189 polypeptide=Lus10010176 locus=Lus10010176.g ID=Lus10010176.BGIv1.0 annot-version=v1.0
MDKLTVEQLKALKEQTDLEVNLLQDSLTNIRTATTRLDLASSALHDLSLRPQGKKMLVPLTASLYVPGTLDDSDNVLVDIGTGYFVEKTMVEGKDYCERK
INLLKSNYDQLLELASKKKSVADEAGVVLQAKLKQMAAPSP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G23290 PFD5, PDF5 prefoldin 5 (.1) Lus10010176
[exp]
0 1
AT5G64080 AtXYP1 xylogen protein 1, Bifunctiona... Lus10021604
[exp]
7.5 0.7849
AT4G12340 copper ion binding (.1) Lus10032225
[exp]
7.6 0.7880
AT2G26110 Protein of unknown function (D... Lus10019517
[exp]
8.3 0.7832
AT3G52300 ATPQ "ATP synthase D chain, mitocho... Lus10023337
[exp]
11.2 0.7695
AT1G61150 LisH and RanBPM domains contai... Lus10018464
[exp]
12.8 0.7791
AT2G01818 PLATZ transcription factor fam... Lus10013242
[exp]
14.4 0.6650
AT4G02580 NADH-ubiquinone oxidoreductase... Lus10024851
[exp]
18.7 0.7605
AT5G44120 ATCRA1, CRU1, C... CRUCIFERINA, RmlC-like cupins ... Lus10011816
[exp]
19.2 0.7421
AT1G08480 SDH6 succinate dehydrogenase 6, unk... Lus10008448
[exp]
22.3 0.7799
AT1G28120 unknown protein Lus10030429
[exp]
24.9 0.7568

Lus10010176 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.