Lus10010180 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G19920 39 / 0.0007 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017384 169 / 6e-51 AT3G19920 327 / 8e-108 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G073600 62 / 4e-12 AT3G19920 119 / 9e-31 unknown protein
PFAM info
Representative CDS sequence
>Lus10010180 pacid=23154233 polypeptide=Lus10010180 locus=Lus10010180.g ID=Lus10010180.BGIv1.0 annot-version=v1.0
ATGGCCGCCGTGAGGGCAGGGATGGGACCGTTGGAAATGATGGAGTACTACAAGAAGAACATCTACTACAACAACAAGAAGGCGGCGGCGCCGGCGTCGA
GCATGCTGAACGCTCTGTTCATGTCGACGGTCAACGCCGCCTCCAGAACTCTAGGCAACGTGGCGTCCAACATACAGCCTGACCACGGCGACAGGTGGAG
GCCCACCGACCACCTCCGGTTCATGGTCATGCTCATGTCGTGGCTCACGGTCTGGGCCGTGAGGGTTCTTATGGATTTCTTGCCCGTGCCGTCAATCACG
TGGTCCCCAGTCAGCCACCTCCTCTCCGCCGCCATTTCGCCCCTTAAGCTTGCCCTGCCGGCAGCTCCGGCAGTATTGGCGGTGTGTTGGCGGCGCCGTT
TTCTTCGGCGGTGGCGGCTGGGAAGGTGA
AA sequence
>Lus10010180 pacid=23154233 polypeptide=Lus10010180 locus=Lus10010180.g ID=Lus10010180.BGIv1.0 annot-version=v1.0
MAAVRAGMGPLEMMEYYKKNIYYNNKKAAAPASSMLNALFMSTVNAASRTLGNVASNIQPDHGDRWRPTDHLRFMVMLMSWLTVWAVRVLMDFLPVPSIT
WSPVSHLLSAAISPLKLALPAAPAVLAVCWRRRFLRRWRLGR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G19920 unknown protein Lus10010180 0 1
AT1G07175 unknown protein Lus10018252 2.4 0.8087
AT5G26650 MADS AGL36 AGAMOUS-like 36 (.1) Lus10016180 2.6 0.8379
AT4G23160 CRK8 cysteine-rich RLK (RECEPTOR-li... Lus10031579 3.5 0.8332
AT3G15280 unknown protein Lus10005404 6.0 0.8080
AT1G76510 ARID ARID/BRIGHT DNA-binding domain... Lus10026569 9.2 0.7751
AT2G29040 Exostosin family protein (.1) Lus10003440 11.6 0.7849
AT1G30840 ATPUP4 purine permease 4 (.1.2) Lus10008073 15.5 0.7434
Lus10019810 17.1 0.7806
AT5G24090 ATCHIA chitinase A (.1) Lus10037984 20.9 0.6662
AT4G12570 UPL5 ubiquitin protein ligase 5 (.1... Lus10027324 21.3 0.5781

Lus10010180 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.