Lus10010186 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G23250 113 / 3e-32 Succinyl-CoA ligase, alpha subunit (.1.2)
AT5G08300 113 / 1e-31 Succinyl-CoA ligase, alpha subunit (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017389 120 / 2e-34 AT5G08300 588 / 0.0 Succinyl-CoA ligase, alpha subunit (.1)
Lus10040992 110 / 1e-30 AT5G08300 591 / 0.0 Succinyl-CoA ligase, alpha subunit (.1)
Lus10010187 107 / 2e-29 AT5G08300 588 / 0.0 Succinyl-CoA ligase, alpha subunit (.1)
Lus10013440 93 / 7e-24 AT5G08300 422 / 3e-148 Succinyl-CoA ligase, alpha subunit (.1)
Lus10003877 74 / 2e-17 AT5G23250 198 / 6e-63 Succinyl-CoA ligase, alpha subunit (.1.2)
Lus10006405 71 / 4e-16 AT5G08300 80 / 2e-17 Succinyl-CoA ligase, alpha subunit (.1)
Lus10017337 46 / 3e-07 AT5G08300 132 / 8e-38 Succinyl-CoA ligase, alpha subunit (.1)
Lus10000263 40 / 5e-05 AT2G35730 54 / 1e-09 Heavy metal transport/detoxification superfamily protein (.1)
Lus10017331 0 / 1 AT5G08300 171 / 5e-52 Succinyl-CoA ligase, alpha subunit (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G036200 110 / 8e-31 AT5G23250 496 / 6e-178 Succinyl-CoA ligase, alpha subunit (.1.2)
Potri.015G028200 110 / 1e-30 AT5G23250 507 / 0.0 Succinyl-CoA ligase, alpha subunit (.1.2)
Potri.005G091400 109 / 2e-30 AT5G23250 515 / 0.0 Succinyl-CoA ligase, alpha subunit (.1.2)
Potri.016G071850 35 / 0.0006 AT5G23250 0 / 1 Succinyl-CoA ligase, alpha subunit (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0063 NADP_Rossmann PF02629 CoA_binding CoA binding domain
Representative CDS sequence
>Lus10010186 pacid=23154226 polypeptide=Lus10010186 locus=Lus10010186.g ID=Lus10010186.BGIv1.0 annot-version=v1.0
ATGCCACCAGACTCGTGGCCTCTTTGTCTTCCAAGCTTCACTCTCCCACTCCCCAAATCACTCCTATCTCCTCCCAAACTTTGTCGCAATCGTGGTCCTT
CGCCTCCGGCGGTGTTTGTCGGCAAGAACACACGCGTCGTTTGCCAGGGAATCACCGGAAAGAACGGGACTTTTCACACCGAACAAGCCATTGAATATGG
CACCAAGATGGTTGGAGGAGTCACACCTAAGAAGGGTGGCACAGAACACTTTGGCCTTCCTGTCTTCAACTCCGTCGCTTAA
AA sequence
>Lus10010186 pacid=23154226 polypeptide=Lus10010186 locus=Lus10010186.g ID=Lus10010186.BGIv1.0 annot-version=v1.0
MPPDSWPLCLPSFTLPLPKSLLSPPKLCRNRGPSPPAVFVGKNTRVVCQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHFGLPVFNSVA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G08300 Succinyl-CoA ligase, alpha sub... Lus10010186 0 1
Lus10027352 1.0 0.9236
AT5G08300 Succinyl-CoA ligase, alpha sub... Lus10010185 1.4 0.9165
AT2G47830 Cation efflux family protein (... Lus10009817 3.5 0.8283
AT1G68552 CPuORF53 conserved peptide upstream ope... Lus10034317 4.9 0.8337
AT4G30360 ATCNGC17 cyclic nucleotide-gated channe... Lus10008900 6.6 0.7857
AT3G17740 unknown protein Lus10031899 7.5 0.7948
AT3G06790 plastid developmental protein ... Lus10037488 8.5 0.7904
AT3G14470 NB-ARC domain-containing disea... Lus10022351 9.5 0.8123
AT2G42010 PLDBETA1 phospholipase D beta 1 (.1) Lus10026377 10.2 0.7496
AT4G10940 RING/U-box protein (.1) Lus10001535 11.2 0.7974

Lus10010186 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.