Lus10010188 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G08290 293 / 4e-104 YLS8 YELLOW-LEAF-SPECIFIC GENE 8, mRNA splicing factor, thioredoxin-like U5 snRNP (.1)
AT3G24730 93 / 9e-25 mRNA splicing factor, thioredoxin-like U5 snRNP (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017390 294 / 3e-104 AT5G08290 290 / 1e-102 YELLOW-LEAF-SPECIFIC GENE 8, mRNA splicing factor, thioredoxin-like U5 snRNP (.1)
Lus10022811 97 / 1e-26 AT3G24730 261 / 7e-91 mRNA splicing factor, thioredoxin-like U5 snRNP (.1)
Lus10011878 94 / 4e-25 AT3G24730 258 / 1e-89 mRNA splicing factor, thioredoxin-like U5 snRNP (.1)
Lus10010189 87 / 6e-23 AT5G08290 87 / 4e-23 YELLOW-LEAF-SPECIFIC GENE 8, mRNA splicing factor, thioredoxin-like U5 snRNP (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G072700 289 / 1e-102 AT5G08290 293 / 5e-104 YELLOW-LEAF-SPECIFIC GENE 8, mRNA splicing factor, thioredoxin-like U5 snRNP (.1)
Potri.001G287600 79 / 2e-19 AT3G24730 245 / 8e-85 mRNA splicing factor, thioredoxin-like U5 snRNP (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF02966 DIM1 Mitosis protein DIM1
Representative CDS sequence
>Lus10010188 pacid=23154201 polypeptide=Lus10010188 locus=Lus10010188.g ID=Lus10010188.BGIv1.0 annot-version=v1.0
ATGTCGTACTTGCTGCCGCACTTACACTCGGGATGGGCTGTCGATCAGTCCATCCTTGCCGAAGAAGAGCGTCTTGTGGTCATCCGATTCGGCCACGATT
GGGATGAAACCTGTATGCAGATGGATGAAGTGCTGGCAGGAGTTGCTGATACACTAAAGAACTTTGCAGTGATCTACTTGGTGGATATCACAGAGGTGCC
TGATTTCAACACAATGTACGAGCTGTACGATCCATCGACTGTCATGTTCTTCTTCAGGAACAAGCATATCATGATTGATCTAGGAACTGGAAACAACAAC
AAGATCAACTGGGCTCTCAAGGACAAACAGGAGTTTATCGACATTGTCGAGACAGTTTACCGCGGTGCTAGGAAGGGACGTGGTCTGGTTATCGCTCCTA
AAGACTACTCAACCAAGTACCGGTACTAG
AA sequence
>Lus10010188 pacid=23154201 polypeptide=Lus10010188 locus=Lus10010188.g ID=Lus10010188.BGIv1.0 annot-version=v1.0
MSYLLPHLHSGWAVDQSILAEEERLVVIRFGHDWDETCMQMDEVLAGVADTLKNFAVIYLVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNN
KINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G08290 YLS8 YELLOW-LEAF-SPECIFIC GENE 8, m... Lus10010188 0 1
AT5G09830 BolA-like family protein (.1) Lus10020861 1.4 0.8999
AT2G18050 HIS1-3 histone H1-3 (.1.2) Lus10014267 4.2 0.8624
AT4G28240 Wound-responsive family protei... Lus10018535 4.8 0.8500
AT3G16175 Thioesterase superfamily prote... Lus10006837 4.9 0.8669
AT5G39360 EDL2 EID1-like 2 (.1) Lus10025639 5.7 0.8736
AT3G29280 unknown protein Lus10018197 6.2 0.8370
AT1G26550 FKBP-like peptidyl-prolyl cis-... Lus10019084 6.9 0.8627
AT3G55920 Cyclophilin-like peptidyl-prol... Lus10030408 7.3 0.8751
AT1G04290 Thioesterase superfamily prote... Lus10004288 7.4 0.8675
AT4G35750 SEC14 cytosolic factor family ... Lus10021230 7.4 0.8274

Lus10010188 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.