Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G23140 360 / 4e-127 NCLPP7, NCLPP2, CLPP2 nuclear-encoded CLP protease P7 (.1) AT1G02560 172 / 9e-53 NCLPP5, NCLPP1, CLPP5 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) AT1G66670 146 / 2e-42 NCLPP3, NCLPP4, CLPP3 CLP protease proteolytic subunit 3 (.1) AT5G45390 140 / 2e-40 NCLPP3, NCLPP4, CLPP4 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) AT1G12410 131 / 4e-37 EMB3146, CLP2, NCLPP2, CLPR2 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1) ATCG00670 129 / 6e-37 PCLPP, ATCG00670.1, CLPP1 CASEINOLYTIC PROTEASE P 1, plastid-encoded CLP P (.1) AT1G11750 128 / 8e-36 NCLPP6, NCLPP1, CLPP6 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) AT4G17040 127 / 3e-35 HON5, CLPR4 happy on norflurazon 5, CLP protease R subunit 4 (.1) AT1G09130 124 / 1e-33 ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.1), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.2), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.3) AT1G49970 85 / 7e-19 SVR2, NCLPP5, CLPR1 SUPPRESSOR OF VARIEGATION 2, NUCLEAR CLPP 5, CLP protease proteolytic subunit 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017397 [exp] 459 / 2e-166 AT5G23140 394 / 1e-140 nuclear-encoded CLP protease P7 (.1) Lus10040981 [exp] 313 / 3e-108 AT5G23140 350 / 1e-122 nuclear-encoded CLP protease P7 (.1) Lus10013434 [exp] 311 / 3e-107 AT5G23140 347 / 3e-121 nuclear-encoded CLP protease P7 (.1) Lus10040982 [exp] 297 / 2e-101 AT5G23140 338 / 5e-118 nuclear-encoded CLP protease P7 (.1) Lus10013435 [exp] 173 / 2e-52 AT5G23140 209 / 5e-66 nuclear-encoded CLP protease P7 (.1) Lus10002422 [exp] 154 / 8e-46 AT1G02560 361 / 4e-126 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Lus10001450 [exp] 156 / 1e-45 AT1G02560 365 / 1e-126 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Lus10025022 [exp] 135 / 3e-38 AT1G02560 313 / 3e-107 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Lus10010003 [exp] 135 / 3e-38 AT1G02560 308 / 2e-105 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G092600 [exp] 373 / 3e-132 AT5G23140 380 / 3e-135 nuclear-encoded CLP protease P7 (.1) Potri.007G071700 [exp] 372 / 2e-131 AT5G23140 383 / 1e-135 nuclear-encoded CLP protease P7 (.1) Potri.014G119700 [exp] 172 / 2e-52 AT1G02560 493 / 6e-178 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Potri.002G195200 [exp] 171 / 4e-52 AT1G02560 474 / 2e-170 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Potri.004G092100 [exp] 155 / 8e-46 AT1G66670 441 / 2e-156 CLP protease proteolytic subunit 3 (.1) Potri.003G103300 [exp] 143 / 2e-41 AT5G45390 383 / 9e-135 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) Potri.004G152900 [exp] 135 / 7e-39 AT1G11750 397 / 4e-141 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) Potri.009G114001 [exp] 134 / 4e-38 AT1G11750 353 / 2e-123 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) Potri.001G115900 [exp] 127 / 2e-35 AT1G12410 408 / 3e-145 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1) Potri.003G083300 [exp] 126 / 1e-34 AT4G17040 441 / 2e-157 happy on norflurazon 5, CLP protease R subunit 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0127 [flax] [poplar] ClpP_crotonase PF00574 [flax] [poplar] CLP_protease Clp protease
Representative CDS sequence Show only first row Show all	>Lus10010196 pacid=23154209 polypeptide=Lus10010196 locus=Lus10010196.g ID=Lus10010196.BGIv1.0 annot-version=v1.0 ATGAACGCTCTCATCTCCCGCGCTAGGGTGTTCGCCTCCGGCACAGTCCTCTCCCGCAGCTGTACCGCCGCCTCCCCCTTCCCCGCCGGTTCCCGCGCCT ACAGTCTAATTCCAATGGTAATCGAGCACTCTTCCCGTGGCGAGAGAGCCTACGACATCTTCTCCAGGCTCCTGAAGGAACGGATTGTCTGTATTAACGG TCCGATCAACGACGATACTGCTCACGTTGTCGTCGCTCAGCTCCTCTACCTGGAATCTGAGAATCCTTCCAAGCCTATCAACATGTACCTCAACTCTCCC GGCGGCCAAGTCACTGCAGGTCTGGCTATCTATGATACCATGCAGTACATCAAGTCTCCGATCAACACCATCTGTTTGGGCCAAGCTGCATCAATGGCTT CGCTTCTTTTGGCTGCGGGAGCAAAGGGTGAGAGGATGTCGCTTCCAAATGCAACCATTATGATCCATCAGCCATCTGGTGGATACAGTGGGCAAGCCAA GGACATTTCCATCCACACAAAGCAGATCATCCGCGTTTGGGATGCGCTGAATGACCTTTACTCGAAACACACGGGTCAACCAGTTGATGTAATTGAGAAG AACATGGACCGGGACTACTTCATGACCGCTAATGAGGCCAAGGAGTTCGGCATTATCGACAATGTGATTGACCACCGGCCCACGAATTTGGTGACTGATG CTGTTGCCGAGGAAAGCAAACAAAAGGGTTGA
AA sequence Show only first row Show all	>Lus10010196 pacid=23154209 polypeptide=Lus10010196 locus=Lus10010196.g ID=Lus10010196.BGIv1.0 annot-version=v1.0 MNALISRARVFASGTVLSRSCTAASPFPAGSRAYSLIPMVIEHSSRGERAYDIFSRLLKERIVCINGPINDDTAHVVVAQLLYLESENPSKPINMYLNSP GGQVTAGLAIYDTMQYIKSPINTICLGQAASMASLLLAAGAKGERMSLPNATIMIHQPSGGYSGQAKDISIHTKQIIRVWDALNDLYSKHTGQPVDVIEK NMDRDYFMTANEAKEFGIIDNVIDHRPTNLVTDAVAEESKQKG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G23140		NCLPP7, NCLPP2,...	nuclear-encoded CLP protease P...		Lus10010196 [exp]	0	1
AT1G20200		HAP15, EMB2719	HAPLESS 15, EMBRYO DEFECTIVE 2...		Lus10034469 [exp]	4.8	0.9195
AT2G44065			Ribosomal protein L2 family (....		Lus10001572 [exp]	9.8	0.9070
AT5G64670			Ribosomal protein L18e/L15 sup...		Lus10023078 [exp]	10.3	0.9162
AT1G10580			Transducin/WD40 repeat-like su...		Lus10030620 [exp]	21.9	0.9058
AT1G27090			glycine-rich protein (.1)		Lus10037224 [exp]	26.4	0.9068
AT1G31690			Copper amine oxidase family pr...		Lus10013356 [exp]	28.5	0.9029
AT5G13780			Acyl-CoA N-acyltransferases (N...		Lus10016378 [exp]	29.4	0.8998
AT4G26670			Mitochondrial import inner mem...		Lus10043170 [exp]	29.7	0.8904
AT2G40800			unknown protein		Lus10012858 [exp]	30.3	0.8989
AT5G01160			RING/U-box superfamily protein...		Lus10021125 [exp]	31.7	0.8967

Compare expression of checked genes

Lus10010196 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.